CAZyme Information: MGYG000000653_00850

Basic Information

• Species: UBA11471 sp000434215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp000434215
• CAZyme ID: MGYG000000653_00850
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000000653_5|CGC1	43312.83	6.2251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000653	2583563	MAG	Germany	Europe

• Gene Location: Start: 5802; End: 6959 Strand: -

Full Sequence      

MKNTFTLLHSVCMVVVLSLLSGCSSEEHREGIVLEEFLYEQADFPSCHSVTIVELENGDL
LATYFGGTHERHPDVEIRLQRKTPGGQWSAPQSVATGIQNDTLRYPTWNPVIFQPDGGEL
MLYYKVGLSPKEWWGEYITSADNGYTWSSPRRLELPLLGPIKNKPIQLADGTLISGSSDE
RHGWRAHIERSTDKGHTWEFIGPLNDGKKIAAIQPAFLQHGGDTIQVLCRTNGKNGNNRI
VQAWSYDAGKSWSEMTETTLPNNNSGIDAVTLRDGRHLLIYNHSTRNQENMGHKGRGVIN
LAVSRDGINWEAALVLDYIDQPEKQYSYPSMIQTADGLVHIVYTWHRQRIKHVVVDPQKL
ETYPIIDGVWPTDKVPFVMSPVDAL

Enzyme Prediction     

No EC number prediction in MGYG000000653_00850.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	40	343	2e-34	0.9093567251461988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	1.51e-107	58	341	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	2.31e-57	37	356	4	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	9.18e-28	47	357	33	373	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd10043	Reelin_repeat_7_subrepeat_1	0.004	165	272	10	124	N-terminal subrepeat of tandem repeat unit 7 of reelin and related proteins. Reelin is an extracellular glycoprotein involved in neuronal development, specifically in the brain cortex. It contains 8 tandemly repeated units, each of which is composed of two highly similar subrepeats and a central EGF domain. This model characterizes the N-terminal subrepeat, which directly contacts the C-terminal subrepeat and the EGF domain in a compact arrangement. Consecutive reelin repeat units are packed together to form an overall rod-like molecular structure. Reelin repeats 5 and 6 are reported to interact with neuronal receptors, the apolipoprotein E receptor 2 (ApoER2) and the very-low-density lipoprotein receptor (VLDLR), triggering a signaling cascade upon binding and subsequent tyrosine phosphorylation of the cytoplasmic disabled-1 (Dab1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ01768.1	7.33e-183	21	380	5	363
QEG35750.1	6.93e-136	6	371	13	362
ACU04978.1	9.42e-136	25	374	25	364
QDT48639.1	1.92e-133	15	371	17	359
QDU44228.1	6.69e-132	6	371	22	371

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000069	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000653_00850.