CAZyme Information: MGYG000000652_02300

Basic Information

• Species: Bacteroides togonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides togonis
• CAZyme ID: MGYG000000652_02300
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	MGYG000000652_26|CGC1	57363.46	6.0651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000652	3410500	MAG	Germany	Europe

• Gene Location: Start: 31980; End: 33530 Strand: +

Full Sequence      

MKKIGTFVLAMCLVVLGACSTQTSSTVQTNDKGTQWEWKNGTIVVKTPERPAGQQSVLGL
TTPKMEVVRVGFVGLGMRGPGAVARFTYIPGTQIVALCDYEQKRAEACQQILKKASLPKA
AIYSGANGYEELCKRDDIDLVYIAADWLHHFPIAKCALENGKNVAIEVPSAMNLKECWEL
INLSETTRKHCMILENCCYDWFEMNTLNMAQNGVFGEVIRAQGAYIHNLSEFWDYYWKNG
EGDKLGWRLDYNMRHRGDVYATHGLGPVAQALDIHRGDRMTTLVAMDTKSVIGKALVEER
TDSTCNNFRNGDHTTTLIRTANGKVIEIQHNVMTPQPYNRLYQLTGTKGFANKYPVEGYA
LDAAQLSASGVQPKVDDLSAHGFMSDADMKALVEKYQHPILKKYGEMAKEVGGHGGMDFI
MDSRLVYCLQNGLPLDMDVYDLAEWCCLAELGELSMDNGCAAVEFPDFTRGEWNVVKGYK
HAYASPEDEAASMEKAKAFTAKLKEQGAKEWAEEGK

Enzyme Prediction     

No EC number prediction in MGYG000000652_02300.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	64	474	6.3e-158	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.50e-21	65	362	1	268	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	3.43e-11	68	193	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.72e-04	66	218	3	145	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM56441.1	0.0	1	514	1	513
QPH58140.1	0.0	1	513	1	511
QBJ17807.1	0.0	1	513	1	511
QMI79300.1	0.0	1	513	1	511
QUT62233.1	0.0	1	513	1	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.63e-83	50	473	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	2.26e-67	68	488	21	443	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E9M_A	8.26e-08	103	255	38	186	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3E82_A	1.26e-07	58	218	3	148	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3EVN_A	1.90e-06	68	219	6	149	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KWM1	0.0	1	514	1	513	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6L1Z2	0.0	1	516	1	516	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KYY1	1.60e-237	28	505	22	499	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	1.20e-207	43	484	32	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
P0C863	1.02e-205	43	484	29	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000021	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000652_02300.