CAZyme Information: MGYG000000652_01621

Basic Information

• Species: Bacteroides togonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides togonis
• CAZyme ID: MGYG000000652_01621
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	MGYG000000652_13|CGC1	54730.97	5.1475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000652	3410500	MAG	Germany	Europe

• Gene Location: Start: 86148; End: 87602 Strand: +

Full Sequence      

MKLIDSYLLYTGNSDIVQTVEGLQATGQTGQITLFGAEAPAALPAGCGFLSAADPFGSQS
LKAIAAQAEAPYTLLYTKDTILSLGMFALERMMRILEDSGAAMAYADHYQLKGGQQTIAP
VIDYQQGSLRDDFDFGSVLLLRTAALKEAAARMKTDYRFAGLYDLRLKLSQRGELVHINE
YLYTEVENDTRRSGEKIFDYVDPKNRNRQLEMEAACTEHLKEVGGYLKPEFEHIEFDRGD
FEYEASVIIPVRNRIRTIRDAIRSVLSQQADFRFNLIVIDNHSTDGTTEAIDEFSSDPRL
IHLIPERNDLGIGGCWNLGVHHPCCGKFAVQLDSDDVYKDEHTLATMVRAFYEQNCAMVV
GTYMMTNFDMQMIPPGIIDHREWTPENGRNNALRINGLGAPRAFYTPVLREVKVPNTSYG
EDYALGLAFSRRFQIGRVYDVVYLCRRWDDNSDASLDVVKMNAHNLYKDRIRTWELQARI
ALNR

Enzyme Prediction     

No EC number prediction in MGYG000000652_01621.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	246	369	2.1e-21	0.711764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	2.66e-21	247	362	1	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	5.58e-19	246	410	1	157	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	1.86e-16	246	341	6	99	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06433	GT_2_WfgS_like	3.60e-16	246	453	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04179	DPM_DPG-synthase_like	1.47e-12	247	372	1	125	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49032.1	6.00e-279	1	484	1	484
QUT44740.1	1.85e-278	1	484	1	484
ADV42422.1	3.46e-278	1	484	1	484
AVM58205.1	3.42e-276	1	484	1	484
AVM52792.1	4.86e-276	1	484	1	484

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4UM29	7.10e-07	244	341	294	388	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q92IF9	9.40e-07	246	341	296	388	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
Q1RIM7	4.00e-06	244	355	292	397	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
O32268	4.51e-06	246	357	9	117	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000652_01621.