CAZyme Information: MGYG000000644_02516

Basic Information

• Species: Prevotella sp900546535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546535
• CAZyme ID: MGYG000000644_02516
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000000644_93|CGC1	43344.6	8.3393

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000644	3556677	MAG	Madagascar	Africa

• Gene Location: Start: 1629; End: 2789 Strand: +

Full Sequence      

MVLKKYLLSAACLLAMQGAMAQVDGVTGASVQAANTSCCKGKKDCSKTPAGQLKTRLQKL
LSKGIMLGHQDDPVYGTTWKWDEGKSDVLLTTGDYPAVMGFDLGKIELDSKENLDGVPFD
RMRKEILAQHKRGGIVTLSWHPWNPATGENAWDPKGDAVAAVLDGGAQQKKFDAWLKKVS
NFILSLKNDKGQLVPVIFRPWHEMNGGWFWWGANSCTPAQYNQLYAKTYHRLTEAGCNNI
VWAWSPNLGDEKNVDAFLERYPGNEFVDLVGVDIYEFDNNDATYQKNLTETLDVMMQAAK
KVNKIPALSETGCRGISQKKNWFTQTLWPVLQKYQLSYVLFWRNAWDKPQEEAYLPGVGD
GAIVNDFKAFKNEKEVLFVKDIKKVK

Enzyme Prediction     

No EC number prediction in MGYG000000644_02516.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	49	322	1.5e-61	0.8547854785478548

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.28e-37	48	285	2	243	Glycosyl hydrolase family 26.
COG4124	ManB2	2.02e-16	134	312	112	296	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67784.1	1.81e-244	20	386	1	367
BCS86241.1	3.59e-139	46	384	19	351
AGH13968.1	2.74e-130	48	386	25	357
QUB85259.1	5.36e-123	48	383	14	348
QUB47762.1	1.83e-115	42	383	24	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	5.05e-97	47	381	8	338	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	2.82e-64	53	378	45	387	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	2.82e-64	53	378	45	387	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	5.11e-64	53	378	68	410	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	2.18e-63	53	378	45	387	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	2.48e-42	57	385	65	414	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	8.84e-31	85	315	84	321	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	9.26e-28	88	346	79	328	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	3.87e-25	53	278	48	269	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
G2Q4H7	1.41e-24	57	306	190	427	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999142	0.000152	0.000155	0.000143	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000644_02516.