CAZyme Information: MGYG000000644_01816

Basic Information

• Species: Prevotella sp900546535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546535
• CAZyme ID: MGYG000000644_01816
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849	MGYG000000644_46|CGC2	96455.2	7.8601

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000644	3556677	MAG	Madagascar	Africa

• Gene Location: Start: 16947; End: 19496 Strand: -

Full Sequence      

MSLTFVSAMPVMADIEISNKSVNGAFAIATPYDATPVCISSSETVVVKKVANMFADDIGR
VTGQKPALNVSKEVSGNRVIVIGTLGSNAFIDKLAKQGKLDVKNIRGGWEQYTIQVVKNP
AKGISEALVVVGSDKRGTAYGTLTISEKMGVSPFYWWTDVPVKLKKEVWLSGKEISKSPT
VKYRGFFINDEDWGLKTWASHTFEKELGDIGPKTYAKVCELILRLKGNMLAPAMHECTGA
FYSHPESKLVADSLGIIITTSHCEPLLINTASKWEWDTKRDGEWNYAVNAKGVQKKWDDR
LKKASSYDNIYTLGMRGLHDAGLRGNLPIDQQTILMNQIIKDQRSLLTKHIKKNIKDIPQ
IYVPYKEAMDVYENGLHVPEDITLVWVDDNYGYMKRVSNPKEQKRRGHSGVYYHLSYLGA
PHDYLWLNTTPPVLMYEELMKSYNTGADRYWLLNVGDIKPMELGIKTFFDLAWNVDAYNI
QNINNHQSKFLGHLFGEAYTSRFQNILDTYYQLAWSRKPEFMGWEREWDTKEYTGLRDTE
FSFQNYGEAQRRLMEYEQLANNVKSLMNELQANQRDAFFEILGHPVMASYQMNRKFLMAQ
LNHEQFKLGNLEEANWAARQSQEAFDSIATLNKQYNSVAGGKWDDMMNMAPAWCSLSHKM
PEINITKDCDEAPIDLSIKQEPLDKCYVVDLRKYANKVEKRGNKISLVEGLGYDWKVIQL
GTPTCKGGDANDLNGDRIEYTIPFINADEVEITLYTVPFFPIYKGKTTKIGVSVDGSQAQ
VFNNEFKEYGKSWKDQVLRNGAVARLKFKIDKTQPSHTISFICGDAGMMIQKVIIDWGGL
KKSYLGPQF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	25	833	1.8e-225	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	8.56e-168	177	521	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	7.08e-23	694	847	16	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam05124	S_layer_C	1.42e-04	70	148	143	220	S-layer like family, C-terminal region.
pfam03648	Glyco_hydro_67N	0.003	68	142	52	117	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDV07546.1	1.39e-267	9	848	13	961
ALK86808.1	2.31e-266	39	848	36	962
QVJ80642.1	1.87e-249	37	833	27	792
AYD49386.1	2.74e-245	1	848	11	961
APZ45930.1	1.32e-244	13	847	23	954

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	7.11e-163	36	835	27	773	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	3.36e-135	36	845	54	844	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
4ZMH_A	2.36e-123	23	847	11	930	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	7.69e-113	35	845	26	829	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.19e-110	35	845	25	828	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.793550	0.205389	0.000353	0.000306	0.000154	0.000260

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000644_01816.