CAZyme Information: MGYG000000639_01749

Basic Information

• Species: Treponema_D sp900541945
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900541945
• CAZyme ID: MGYG000000639_01749
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000000639_209|CGC1	39935.96	6.7142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000639	2201404	MAG	Madagascar	Africa

• Gene Location: Start: 616; End: 1656 Strand: -

Full Sequence      

MKRLFLILLIFCAVFSVSAKNNESLEYLKNSRKTAYRQKTISGDAVEMQEIWGWVMQSRF
SEFDNALPLTDVGFFAADVDSYGNLANVPDRSKLANFPGRVHLVLVCDSKSLTHFVLDPK
FGLADNMIKQIMEAAEPFDGINVDYELIPAKDGQNFLNFLEKLKNECKKNGKMFTVCVPA
RIRTIEDDVFPYKKIADMADRVMIMAYDEHWSTSRPGPIASMNWCEKIAGYAVTVIPQEK
LVMGLPFYGRSWANEKPAQAWYFEGVNRIIDEYKSGRVTYVNDIPNVEVTMKVKADFWFE
DAYSTVAKMRLYKNFDVNKIAFWRIGQEDKNIWRWIKMEENSAENK

Enzyme Prediction     

No EC number prediction in MGYG000000639_01749.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	124	335	4.2e-35	0.6891891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	3.43e-50	69	334	26	311	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	3.87e-40	109	336	178	418	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	3.78e-29	108	333	75	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	3.10e-22	108	327	75	306	Glycosyl hydrolases family 18.
smart00636	Glyco_18	1.83e-18	125	327	93	333	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL96450.1	8.11e-108	28	339	42	352
QTQ11038.1	2.25e-103	39	337	124	419
QTQ17017.1	2.25e-103	39	337	124	419
QTQ14800.1	2.42e-103	39	337	93	388
QBY91897.1	3.97e-97	5	337	9	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JH8_A	1.23e-17	138	333	105	307	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
3CZ8_A	1.71e-17	109	325	82	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	7.20e-17	69	336	133	421	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4Q6T_A	2.69e-16	111	333	86	332	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4WIW_A	2.66e-13	133	331	128	335	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	2.49e-17	109	325	174	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	3.89e-16	69	336	132	420	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	4.21e-15	69	336	132	420	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O31682	1.96e-14	120	258	76	218	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
P37531	2.05e-12	69	341	131	424	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000364	0.998836	0.000287	0.000159	0.000165	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000639_01749.