CAZyme Information: MGYG000000634_01703

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Rhodocyclaceae; SFHR01
• CAZyme ID: MGYG000000634_01703
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000000634_98|CGC1	38188.5	10.0457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000634	1737692	MAG	Madagascar	Africa

• Gene Location: Start: 969; End: 1982 Strand: -

Full Sequence      

MLGDYFLMVDLKKTILRKDEKILLMNPKVGGVILFARNFQDEKQLRQLIASIRELDRPRL
LIAVDQEGGRVQRFKTAPFTMLPPMAKLGALFDENPQLARRAARALGGVLGHELKFFDID
LTFAPVLDLDYGASSVIGNRAFHRNPKVVVALAKAFLKGLTAAGVAHCGKHFPGHGFVSA
DSHTDLPIDERVFAEMQDDFYPYEHLHLKAVMAAHVIYKTLDDETAVFSKTWINKLRRDF
RFKGAIFTDDLSMQGAKEKAANIVQRVEKAWAAGCDMALICNDLNSALIAVDRWKPEFRN
DHPARMKRLKNLFLIKNDSGKEYEKQRRFLKTHGLII

Enzyme Prediction     

EC	3.2.1.52

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	52	279	3.4e-43	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05337	PRK05337	4.21e-140	6	336	3	329	beta-hexosaminidase; Provisional
COG1472	BglX	7.14e-85	18	311	19	313	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	7.38e-72	7	291	10	295	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKV56843.1	8.67e-102	7	309	9	306
AXS79825.1	1.41e-100	7	312	9	309
QRM19747.1	1.61e-99	7	312	9	309
ART37136.1	9.16e-99	7	297	12	300
SMB26118.1	1.40e-97	7	296	15	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4G6C_A	2.05e-90	8	310	15	319	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315],4G6C_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315]
4GNV_A	2.18e-90	8	310	17	321	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4GNV_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4MSS_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],4MSS_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],5UTP_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTP_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTQ_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTQ_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTR_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],5UTR_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],6DTE_A GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia],6DTE_B GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia]
6JTI_A	4.22e-79	8	282	48	326	Crystalstructure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_B Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_C Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_D Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_E Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_F Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTJ_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTK_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTL_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae],6JTL_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae]
5G1M_A	6.43e-76	7	332	25	341	Crystalstructure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G1M_B Crystal structure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G2M_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G2M_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G3R_A Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G3R_B Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G5K_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5G5K_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
5G5U_A	2.03e-74	7	332	25	341	Crystalstructure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G5U_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_A Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_B Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5LY7_A Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5LY7_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WH65	1.79e-92	8	328	17	345	Beta-hexosaminidase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=nagZ PE=3 SV=1
Q7W9J5	1.79e-92	8	328	17	345	Beta-hexosaminidase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=nagZ PE=3 SV=2
Q7VWV8	5.58e-91	8	328	17	344	Beta-hexosaminidase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) OX=257313 GN=nagZ PE=3 SV=1
Q5P081	1.63e-88	8	311	18	325	Beta-hexosaminidase OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=nagZ PE=3 SV=1
Q3SKU2	5.07e-88	7	282	6	284	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000634_01703.