CAZyme Information: MGYG000000632_00989

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000632_00989
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		48843.49	9.2373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000632	2314202	MAG	Madagascar	Africa

• Gene Location: Start: 5046; End: 6359 Strand: +

Full Sequence      

MKITPGLYRAITTVALPLASLYLMWRSRRQPAYRDYWDERFAWGTYPLRTQRPRVWIHAV
SVGETNAAKPLLEAMLSAWPECDVILTHMTPTGREAGKKLVRMAPERIHQCYLPYDAPYA
VEKFVRQTRPTLGVIMETEVWPNLMREMKRRQIPVVLANARESEKSRAQAARFMDIMAPA
FSSFSAVLAQSDEDKERLESLGAVDVQVTGSVKFDIRPDLSQVATAKALAARLTRPVILI
ASTRDGEEAMFAEALKTHADLLRKTHVVLVPRHPERFDRVEALLKESGFRVVRRSRLQAP
EELPPDTDVILGDSMGEMSFYCALASVTIMGGSFAPCGSQNVIEPAMAGSPVVVGPSTFN
FERIIREGIAAGGMVQVKSAAESLDVVEKWLADPQERELAGARAADFARRCAGATGRMMA
VLEKLWTYARKNESRMY

Enzyme Prediction     

EC	2.4.99.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	37	216	1.3e-64	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	6.17e-173	7	425	5	420	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	4.67e-148	7	425	4	418	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	3.54e-76	38	216	1	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
cd03814	GT4-like	0.002	341	410	282	350	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases and includes a sequence annotated as alpha-D-mannose-alpha(1-6)phosphatidyl myo-inositol monomannoside transferase from Bacillus halodurans. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA54730.1	3.46e-302	1	437	1	437
QQS89703.1	2.14e-243	1	436	1	436
BBF22154.1	3.38e-216	14	437	2	425
ANU66484.1	1.14e-121	7	425	7	430
QQQ97632.1	1.14e-121	7	425	7	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	1.03e-26	48	401	36	361	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	1.75e-25	235	424	42	229	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q45374	9.55e-90	9	423	3	424	3-deoxy-D-manno-octulosonic acid transferase OS=Bordetella pertussis OX=520 GN=waaA PE=1 SV=1
P0AC76	3.09e-73	7	423	5	417	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P0AC77	3.09e-73	7	423	5	417	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC75	3.09e-73	7	423	5	417	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
P44806	1.24e-64	8	423	6	420	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.992986	0.006519	0.000431	0.000023	0.000013	0.000039

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000632_00989.