CAZyme Information: MGYG000000621_00898

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor
• CAZyme ID: MGYG000000621_00898
• CAZy Family: GH32
• CAZyme Description: 5-dehydro-2-deoxygluconokinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772	MGYG000000621_18|CGC1	87317.53	4.6742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000621	3027354	MAG	Madagascar	Africa

• Gene Location: Start: 13314; End: 15632 Strand: -

Full Sequence      

MREIVRPSLHFTPQKGWINDPNGLVFFKGQYHLFYQYNPYHDNWDSMHWGHAVSRDLIHW
EELEPALVPDMPYDNDKNGGCFSGSVVVHDDQLFLFYTGRTEDETGIFETQNLAVSKDGI
HFVKAEENPLIKEVPEKGGRDFRDPKVFFAQGKWRMICGGSTGRIEHPDSCGRIYLFSST
DLYHWTYSGILYEAEPGEGRMFECPDAFCLDDVWFLTTSPMYEKDSVTTLYLSGQVDFDK
CEFHKEISGTLDLGTHYYAAQTYPVLNGEIRSVAWLGGWLWMPWIRDFGPEEGYRGILDV
SRVWYLDDNRRLCAKVADTVKSEMKVFSRTLENHWTGENIPPQSQPVMVELKGKLPGDGE
LLCIDLYDTDRHTVTICFDSSNKEMTVNYNRADRASRYGIRTISCEMMEKETDIDILIDG
NAFTLLWEHGLYRYTGKLYPQGNIGVDIKCRAKQHYDITSLGEILIDFTGKKESERQTLS
YTQNPGGAPANVVVAAQRLGAQTAFIGKIGEDFLGDFLKETLDKCGVSTEGLISDADYFT
TLAFVKLADNGERNFAFARKPGADIGLKGEEVRKDIICQSRILHVGSLSLTDEISRNAEF
IALKAAKNNGTIISYDPNYRAGLWDSQEEACKWMRSILEYADIVKVSEEEIELLTGYTDV
RKAAESITEYGAKIVLITLGEKGSFVYLQDQQEAYVPGYSSKVVDTTGAGDSFMGGFLYK
ICESGKRIEEYSLQEMIECVRFGNAVASLCVEREGAIPAMPVMEEVIKRINS

Enzyme Prediction     

No EC number prediction in MGYG000000621_00898.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	10	313	7.3e-89	0.9863481228668942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08996	GH32_FFase	5.25e-116	16	306	1	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd01167	bac_FRK	2.26e-102	458	757	2	295	Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate. This is in contrast to FRKs [or ketohexokinases (KHKs)] from mammalia and halophilic archaebacteria, which phosphorylate fructose to fructose-1-phosphate.
pfam00251	Glyco_hydro_32N	2.83e-100	10	310	1	301	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	4.56e-97	10	419	1	426	Glycosyl hydrolases family 32.
cd18625	GH32_BfrA-like	1.21e-92	16	280	1	264	glycoside hydrolase family 32 protein such as Thermotoga maritima invertase (BfrA or Tm1414). This subfamily of glycosyl hydrolase family GH32 includes beta-fructosidase (invertase, EC 3.2.1.26) that cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02729.1	0.0	1	772	1	772
QNM03128.1	3.64e-90	5	312	9	318
ADB10727.1	8.13e-89	5	430	6	431
BAQ28033.1	1.36e-88	5	430	24	449
VEG24706.1	1.57e-88	5	430	29	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UYP_A	1.91e-64	4	355	1	334	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]
1W2T_A	5.09e-64	4	355	1	334	beta-fructosidasefrom Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_B beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_C beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_D beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_E beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_F beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8]
7VCO_A	6.99e-60	7	440	27	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	2.42e-59	6	302	49	336	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	3.18e-58	6	302	49	336	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O82616	3.54e-70	458	772	7	321	Probable fructokinase-5 OS=Arabidopsis thaliana OX=3702 GN=At4g10260 PE=2 SV=1
A2WXV8	3.64e-66	458	772	8	322	Fructokinase-1 OS=Oryza sativa subsp. indica OX=39946 GN=FRK1 PE=1 SV=1
Q9M1B9	3.98e-66	458	766	11	319	Probable fructokinase-4 OS=Arabidopsis thaliana OX=3702 GN=At3g59480 PE=2 SV=1
Q0JGZ6	9.81e-66	458	772	8	322	Fructokinase-1 OS=Oryza sativa subsp. japonica OX=39947 GN=FRK1 PE=1 SV=2
Q42896	1.58e-65	458	767	12	321	Fructokinase-2 OS=Solanum lycopersicum OX=4081 GN=FRK2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000621_00898.