CAZyme Information: MGYG000000614_00835

Basic Information

• Species: Parolsenella massiliensis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Parolsenella; Parolsenella massiliensis
• CAZyme ID: MGYG000000614_00835
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000000614_10|CGC1	39191.37	5.2598

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000614	1784936	MAG	Madagascar	Africa

• Gene Location: Start: 23604; End: 24686 Strand: +

Full Sequence      

MLRHRNKRSEAAAQEAPARPLHGVNLSGWLVLEPWVTPSLFAGTGAFTELELAGSIEPGR
YRDMIERHRETFVDERDFARIAARGFDAVRLQVPWFVFGEDGPMPGPSAGCIGYVDAAFD
WAEAAGVSVLLDVAVAPGADAASPASFFGDIGAFRQCMLDVVAELASRYAARENFLGIEP
IDEVQGRSRRGLSLVEGVPPHLLRNFYRDAYEALRDAAGTRPVLVLHDACLPDAWRAFMS
PARYVNVWLDSHIYHYAESMNAAGPAGVRRLADASAAYVARARKSGLPVMVGEWSSALPL
ADAGMTPEGRIALERVYTAGQMGAFGGCAGWFFQTWKTEGRLSSWDARVALSSFETGMFD

Enzyme Prediction     

No EC number prediction in MGYG000000614_00835.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	67	310	1.1e-43	0.8576158940397351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	4.50e-17	16	339	13	365	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	2.63e-05	68	294	20	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH50588.1	3.59e-265	1	360	1	360
ADK68544.1	3.76e-131	19	358	4	345
BCV19183.1	1.16e-127	21	360	6	347
SDR87855.1	1.53e-125	19	358	4	345
QOY61077.1	2.88e-123	20	358	5	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	2.73e-33	21	337	3	358	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.93e-32	21	337	3	358	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	3.42e-18	21	339	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	4.63e-18	21	339	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3O6A_A	4.79e-18	21	339	14	367	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RAR6	2.99e-26	21	353	42	399	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
A1CRV0	4.06e-26	21	353	42	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
B8N151	6.80e-26	21	359	31	392	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	6.80e-26	21	359	31	392	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B0XN12	2.73e-25	21	353	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000614_00835.