CAZyme Information: MGYG000000606_00655

Basic Information

• Species: RC9 sp000433355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000433355
• CAZyme ID: MGYG000000606_00655
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1042	MGYG000000606_2|CGC5	117456.65	7.1865

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000606	3291011	MAG	Madagascar	Africa

• Gene Location: Start: 300301; End: 303429 Strand: -

Full Sequence      

MNRFALALAAALFLGQTVASAQSDLPLTDHNGRIAKQHSASSFVVDGNSVQISTKDSGSG
LIFYTDLDVSDYASLKFTIVNRRDAFMMMSVQIQDSVFNANNNAQAKNALSDRLLIFPNE
TREVVIPLPAKLPYPEIYNGFRGMRNTPYSVDEHYSYDVDLSSVKLVKIKAFKHFDGADY
SICDLRFSKGEKAGLPVWMTWDESRFFPFVDKYGQFKHKDWPGKTHSDTDLQKAREKEEE
YLRSHPGAGDWSRYGGWKNGPRLEATGHFRVQKVDGKWWMVDPEGYLFWSHGVVRVTTST
GITPLDGRKEYFEDLPEKGSGMGHFYETYDALLKPYYTVRGIKETYDYSSANAFRKYGPD
YKEAFAELAHRRLRSWGLNTIANSSDKDICLMDRTVYTDRIEISSPIIEGTGGSWWKFMD
PFNDGFAESVRSRLVARKRQLDDPWCLGYFVDNEIKWGDTEYLASCTIMAPATQKAKIAM
VDWLKGRYQDIQRLNGAWKTSFSSWDALLENRNRVPASAKKDLKEFNVKIIEAYFSTVRR
VFKEVAPDVLYLGCRFSGSNADVLNIAAKYCDVLSYNIYRPDLYDFSLPDGIDKPVMIGE
FHFGAMDRGMFHPGLIYTRNQNERADMYYRYVKSAMEHPNVIGTHWHQFSDQACTGRFDG
ENYQVGFTDICDSPYYETVDKVREVGCEMYGIRSGRLASKRDDAVYVDASELGVYGKAGE
VPEHPYSRIDPKKYGIKGSLATKCLQSAGVFVAFSTDSKSISAKWKTSPLAVVGVNTGAN
AQKGLDLYIKKDGRWVFAGVGSPDMKGDCIHHSRTIISSMPEGTKECLLYLPLFDVVDSI
EIGVDPGSSISALPNPFAHKIVFLGSSITHGSAASRAGMSYVARYGRDNGLYCLNLGFSG
QAKLQEYWARVAADIDADAFVFDQFSNPSAKVINESFDSFVDIIREAHPETPLIFLQTIR
RERRNFNEEADAYEAAKQKAGEAKVRARMKTDKNIYFIPSDGFLGDDSLGTADGTHPTDV
GFSRMLEKMSPKLNKILKKYIR

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	66	690	8.2e-147	0.9754977029096478

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14606	Lipase_GDSL_3	1.00e-53	859	1033	2	177	GDSL-like Lipase/Acylhydrolase family.
cd01844	SGNH_hydrolase_like_6	1.26e-40	860	1033	1	177	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
pfam14607	GxDLY	2.88e-38	705	850	2	146	N-terminus of Esterase_SGNH_hydro-type. This domain lies upstream of SGNH hydrolase, but its function is not known. There is a highly conserved GxDLY sequence-motif.
pfam13472	Lipase_GDSL_2	7.64e-12	863	1021	1	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	3.66e-07	861	1032	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53973.1	9.83e-253	19	694	20	685
AXP07840.1	7.53e-214	36	694	56	719
ASV75458.1	4.62e-167	104	696	97	684
QNN24957.1	2.08e-163	116	696	615	1213
AXP07838.1	1.45e-159	115	696	141	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	9.82e-77	202	695	196	748	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	2.53e-76	202	695	196	748	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4LHS_A	2.86e-76	700	1038	3	337	Crystalstructure of a putative GDSL-like lipase (BACOVA_00914) from Bacteroides ovatus ATCC 8483 at 1.40 A resolution [Bacteroides ovatus ATCC 8483]
6XJ9_A	1.18e-75	210	690	223	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	1.62e-75	116	690	129	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	2.78e-85	68	693	291	952	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	2.36e-54	59	723	251	950	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000325	0.998807	0.000234	0.000204	0.000206	0.000181

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000606_00655.