CAZyme Information: MGYG000000604_00815

Basic Information

• Species: UBA1829 sp900549415
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549415
• CAZyme ID: MGYG000000604_00815
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815		93707.04	5.6973

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000604	3604218	MAG	Madagascar	Africa

• Gene Location: Start: 149297; End: 151744 Strand: +

Full Sequence      

MSNMNLASEWTLSSSKPGFAPVPARVPGDNYSALLDAGVIPDPYIAMNEDLVQWVRDFDW
TWSRDFELDEAFLKQNVIFLNIDSVDTFGAIRINGRTVGHSENMFTRFRANVKEFLKAGT
NRIEITIDSALRHAEEEYSKLPVDVPCTGVNSVKHLNLIRKVQCHGGWDWGITLLVSGLY
GKIYLQGVQNARIEHVYSEQEHRAGLCKLTVHAELIADHEGTETVGFTFNGETKSVSAEL
KPGVNTVSVSFEVRNPKLWNPAGYGEQNLYQLTVATADEKLEKKIGLRTLALINEDDEVG
RSMKFRVNGVDIFCKGADWIPMDAMPQRFTRERYHKILSDTVEANMNMLRVWGGGQYENE
DFYELCDELGILIWHDCMFACSHYPSFPHFLGLVREEIEYQVKRLRDHASIALWCGDNEV
ARAINWYPEERRKFLTINYDRLNRAIGETVEKCDPTRTFWPSSPCNGPMDYDESTLKGDM
HYWLVWHSGKPFSAYYDVIPRFCSEFGYQSFPSMNSIDIYCAGRQRNVTSPLMEHHQRNS
GGNSRIMEMFTRYFRFPTGFEDFIYLSQVQQALAIKTGVEFWRHLKPVCMGTLYWQLNDN
WPVASWASIDYYGNWKQLHYAAKRFYSPVVVTCFQNKENNLEIWATSDVQQELKGTLKLS
VFDFDGKAEKVLSFPVELKPLESVKIQETGVPELAPATDKVFAFLELEVSGGGKTYRHYN
DHFFTEYKHCDLREAGIEHSIEQRDGVWHLKLSSKFPAFFVFAELRGVPAVFSDNSFTLL
PGQPRELTFRTDSPVTREELERILSIRDLRGCYTE

Enzyme Prediction     

No EC number prediction in MGYG000000604_00815.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	696	1.8e-99	0.6968085106382979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.01e-108	6	813	15	806	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	8.63e-21	734	810	1	77	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	5.23e-14	639	729	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10340	ebgA	3.12e-12	64	457	115	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	4.34e-07	191	288	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44113.1	6.48e-291	2	813	3	821
QDU34180.1	3.74e-283	1	813	8	835
QQE12237.1	7.00e-282	4	813	11	829
ADK80325.1	9.72e-239	6	788	6	798
AYV24530.1	8.87e-237	1	813	1	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	6.61e-172	22	815	26	840	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	7.00e-172	22	815	28	842	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.85e-171	22	813	28	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	7.52e-171	22	813	26	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	8.07e-170	22	815	26	840	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	1.92e-128	3	813	22	879	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
O00462	2.86e-127	5	813	24	879	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
Q4FZV0	3.00e-127	5	813	24	881	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q8K2I4	1.10e-126	5	813	24	879	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
Q29444	1.24e-124	3	813	22	879	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000604_00815.