CAZyme Information: MGYG000000604_00263

Basic Information

• Species: UBA1829 sp900549415
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549415
• CAZyme ID: MGYG000000604_00263
• CAZy Family: GH37
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503	MGYG000000604_2|CGC2	57500.34	5.327

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000604	3604218	MAG	Madagascar	Africa

• Gene Location: Start: 23644; End: 25155 Strand: +

Full Sequence      

MDQDWFSHVPHPVFDEHPEYIELYNLAWNLAKDHVKHIPGMPQDPYIDESFCESRIWIWD
TCFMTLFCKFSPKDFPGIESFRNLIDVLQDGVRLPLVRIPEGEPAWTGNKPGDLAPILIQ
HPDNPPLFAWAEYENALMSGNREHLKDILRNTKVLQKHYDWLESLKESVLPDQCMIPTRW
IHHEKGYFWGGTPSGMDNTPRGRFSHTDAGPELKDFYWVDAIAQQALTAECIARMAEIIG
DDALAAEWTAHKKEKQELIQKYYWDPVDGFFYDVDPESLKPLRIVTPASFWVLLAGCATP
EQAQLCAEKLLDPELLGGKYPWVTVARNDAKFNADNGLYWHGAVWVPTAYAGTRALLRYG
MFDLAREKVLDMLKHMYDTWKNFSPHTIWECYSPNKPEPAHTPDGVKLVRPDFCGWSALM
PIAGLIENAIGLYEANAFTNTLRWHLSAEAKGKTGCRNYRFGEVVADLIAENGVCSYTSN
REFNLEINGTMHRVPAGSGSFRF

Enzyme Prediction     

No EC number prediction in MGYG000000604_00263.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	212	399	1.5e-17	0.3604887983706721

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.35e-13	232	375	591	742	alpha-glucosidase; Provisional
pfam01204	Trehalase	6.57e-13	232	383	318	466	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	1.20e-12	232	378	367	508	Neutral trehalase [Carbohydrate transport and metabolism].
COG3408	GDB1	8.90e-10	234	432	432	610	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	3.30e-09	118	419	148	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44762.1	2.69e-187	1	497	91	589
QZT38129.1	1.04e-139	10	497	33	496
QIU93173.1	2.28e-135	9	497	32	492
AOW82330.1	1.11e-134	4	501	40	512
QDV72106.1	2.34e-129	5	497	32	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	3.45e-10	232	375	564	715	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	3.45e-10	232	375	564	715	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.45e-10	232	375	564	715	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
7PQQ_B	3.70e-10	232	375	113	264	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]
6XUX_A	3.71e-10	232	375	113	264	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	2.67e-21	126	432	115	394	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
Q757L1	8.70e-11	235	388	505	673	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1
P42592	1.91e-09	232	375	587	738	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
P32356	2.48e-09	245	388	529	687	Cytosolic neutral trehalase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTH1 PE=1 SV=3
Q1RCP3	6.41e-09	232	381	348	492	Periplasmic trehalase OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=treA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999924	0.000076	0.000003	0.000000	0.000000	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000604_00263.