CAZyme Information: MGYG000000592_00291

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000000592_00291
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000000592_20|CGC1	71626.27	6.1667

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000592	2977283	MAG	Madagascar	Africa

• Gene Location: Start: 94; End: 2022 Strand: -

Full Sequence      

MKKNLSVQTFVMSALLTIFACPICAGGNIGHAKTAEMKVKSVKINGYVGGRIDDCILHRV
MGQDVDELVEPFRHRNETWRWQSEFWGKWTLGALETYRYTGDAALYEKIAASVGHIIETR
SPDGYIGNYAPESQLREWDIWGRKYTMLGLLGWYELSGDSQALAAASGVADHLISQLKSK
NAKIVKCGLYRGMASSSVLEPIMKLYDITGNKRYLDFATDIVTQWETQDGPRLVSRSDTP
VALRFPHPQTKWFSYENGAKAYEMMSCYEGLLEYYKVTGNEADYEAVRKSVSHIIEEEIN
IAGSGSSVECWYGGKSLQTIPTYHTMETCVGFTWMQLCSRLLKFCGDSRYADQIEKTFYN
AILGSMKCDGSQIAKYTPLEGWRVEGEKQCHMNINCCNANGPRAFAMIPALAFITEGDCL
KINHYGDSEAEISLDKRNSMGISLHGNYPVSGNISIELSPAKPAEFTLALRIPQWSKTTT
ASVISGTDTLKINLENLSAGEYAKVERRWKKGDRIELSLDLTPHLFELNGHQAIVRGPIV
LARDSRFDDGFVDESVVIQSSEDGSVALTPADNNDFAWMAFTAPMIAGADLEGNGKPRQI
HLCDFASAGNTWDKSTRYKVWLPKTLNVMKGEYRAYNDAPSE

Enzyme Prediction     

No EC number prediction in MGYG000000592_00291.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	77	541	2.1e-54	0.9064885496183206

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	6.94e-57	38	542	13	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	2.12e-55	60	542	20	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG1331	YyaL	8.92e-04	85	224	411	566	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04792	LanM-like	0.001	89	223	553	681	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	9.71e-197	35	642	20	626
QHS51661.1	1.11e-38	31	562	55	592
AXC10260.1	8.31e-37	31	544	86	600
CQR55216.1	2.59e-34	88	540	89	571
AZO69015.1	2.63e-33	81	540	94	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.53e-27	202	548	199	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	7.30e-24	107	540	99	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	3.22e-22	154	572	205	627	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	5.06e-22	107	540	99	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002881	0.352612	0.643723	0.000405	0.000186	0.000163

TMHMM  Annotations     

start	end
7	29