CAZyme Information: MGYG000000591_02119

Basic Information

• Species: Phascolarctobacterium_A succinatutens_A
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A succinatutens_A
• CAZyme ID: MGYG000000591_02119
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208		24694.46	9.4796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000591	2471478	MAG	Madagascar	Africa

• Gene Location: Start: 21516; End: 22142 Strand: +

Full Sequence      

MSVKVNRKARSRRRKKHGRLHSWLLMFGVLLAVCFGCWKIWSSDAVQMRFVYMWDYQQDI
VTYSKKNDVDPFLVAAIIKNESNFKHDAVSKVGAVGLMQIMPETGRWIAEQMGLKQYQDS
DLYQTRTNIRMGCWYVGELEHEFQHNLVLLMVAYNAGRGQTHEWMQENGWDYNFNDVKAI
PYPDTREYVAKVLQDRDKYYLLYKDKLK

Enzyme Prediction     

No EC number prediction in MGYG000000591_02119.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	68	197	1.4e-26	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.11e-76	54	198	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.13e-51	56	204	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.04e-35	71	194	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.02e-30	55	207	138	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.75e-26	63	170	4	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV76946.1	4.70e-139	3	208	1	206
BBG64618.1	3.43e-94	12	208	4	199
QNP77119.1	3.88e-91	23	208	26	210
ADB46849.1	2.55e-67	10	208	3	197
AEQ23289.1	1.24e-62	10	203	2	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.98e-24	52	203	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.00e-24	52	203	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.02e-24	52	203	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.03e-24	52	203	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.05e-24	52	203	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	1.56e-15	39	200	467	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	3.21e-14	76	206	448	578	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P0AGC4	1.11e-13	39	200	467	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.11e-13	39	200	467	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O64046	2.76e-12	52	198	1418	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.988916	0.003401	0.005352	0.000021	0.000011	0.002316

TMHMM  Annotations     

start	end
20	42