CAZyme Information: MGYG000000568_00375

Basic Information

• Species: CAG-279 sp900544305
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900544305
• CAZyme ID: MGYG000000568_00375
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553	MGYG000000568_5|CGC2	62131.65	7.1362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000568	2842092	MAG	China	Asia

• Gene Location: Start: 49958; End: 51619 Strand: -

Full Sequence      

MSDNTKQPDLLFETSWEVCNKVGGIYTVLSTKAKTLHKQFGDNLIFVGPDVWTDETPSPF
FTESKTLLKEWQQKANLPEGVSVRIGRWKVPGNPIAILVKFTALYQYKNLYYAEMWEKFQ
VDSLHAYGDYDEGCAFGIAAALVIKSCASYLAKPNKNKIVAHFDEWTTGMGLLYLKAHAP
EIATVFTTHATSIGRSICGNNKPLYDYFKNYNGDQMAAELNMQSKHSLEKAAAHNADCFT
TVSKITADECEQLLEKRPHVVTPNGFEREFVPKAKNFDIARKNAKSKLLEVASALTGKSF
PENTFLIATSGRSEFRNKGLDLFIDTINNLRNDRTTPTTPIIAFILVPGWTMDARRDLEL
QLKRKKPAEALEDPVITHTLHNYSSDAIYNRMQYLGIHNASYDNVNVIYVPCYLNGSDGI
FNMNYYELLIGMDAAVFASYYEPWGYTPHESTAFGVPTITTTLAGFGQWILSITENGGFD
TCGVEVVKRTDSNYYSSIMDITAHIRKLISAKPAKLKQISKAAINTSKAAEWSKFISYYD
TAYEIALNNLEKH

Enzyme Prediction     

EC	2.4.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT3	13	353	3.6e-119	0.5463108320251178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03793	GT3_GSY2-like	1.40e-95	10	467	3	510	glycogen synthase GSY2 and similar proteins. Glycogen synthase, which is most closely related to the GT3 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis. GSY2, the member of this family in S. cerevisiae, has been shown to possess glycogen synthase activity.
pfam05693	Glycogen_syn	4.97e-88	13	467	1	505	Glycogen synthase. This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P).
COG0438	RfaB	1.02e-11	159	549	87	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	5.75e-06	160	523	85	344	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03809	GT4_MtfB-like	3.96e-05	230	464	133	302	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35215.1	3.70e-238	9	548	9	542
QCD39087.1	2.57e-237	7	552	9	568
QCP72779.1	2.57e-237	7	552	9	568
ANU62732.1	2.07e-235	9	549	9	543
ASB36772.1	2.07e-235	9	549	9	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NAZ_A	9.58e-69	7	547	26	634	Basalstate form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_B Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_C Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NAZ_D Basal state form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NCH_A Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_B Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_C Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3NCH_D Yeast Glycogen Synthase (Gsy2p) Basal State Conformation [Saccharomyces cerevisiae],3O3C_A Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_B Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_C Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3O3C_D Glycogen synthase basal state UDP complex [Saccharomyces cerevisiae],3RSZ_A Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_B Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_C Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RSZ_D Maltodextran bound basal state conformation of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae]
4KQ1_A	3.50e-68	7	547	25	633	Crystalstructure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_B Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_C Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_D Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ2_A Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_B Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_C Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_D Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO]
3NB0_A	3.56e-68	7	547	26	634	Glucose-6-Phosphateactivated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_B Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_C Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_D Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3RT1_A Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_B Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_C Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_D Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],5SUL_A Inhibited state structure of yGsy2p [Saccharomyces cerevisiae S288C],5SUL_B Inhibited state structure of yGsy2p [Saccharomyces cerevisiae S288C]
6U77_A	6.80e-68	7	547	6	614	yGsy2pin complex with small molecule [Saccharomyces cerevisiae S288C],6U77_B yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_C yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_D yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C]
5UX7_A	8.75e-68	7	547	26	634	Activatedstate yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_B Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_C Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_D Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O93869	1.35e-73	10	547	15	603	Glycogen [starch] synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gsy-1 PE=2 SV=2
P13807	2.41e-71	10	548	28	614	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2
A2RRU1	2.45e-71	10	547	28	613	Glycogen [starch] synthase, muscle OS=Rattus norvegicus OX=10116 GN=Gys1 PE=1 SV=1
P13834	3.24e-71	10	547	28	613	Glycogen [starch] synthase, muscle OS=Oryctolagus cuniculus OX=9986 GN=GYS1 PE=1 SV=4
Q9Z1E4	3.41e-71	10	547	28	613	Glycogen [starch] synthase, muscle OS=Mus musculus OX=10090 GN=Gys1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000568_00375.