CAZyme Information: MGYG000000562_00943

Basic Information

• Species: Lachnospira sp000437735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp000437735
• CAZyme ID: MGYG000000562_00943
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000000562_3|CGC6	40947.08	6.8934

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000562	2986625	MAG	China	Asia

• Gene Location: Start: 235435; End: 236517 Strand: -

Full Sequence      

MKIYQLLPTLAFGDAVSNDALALEKVIREMGYKTEIFAESIDARLPKGSAKFVEKLPRLN
EKDIILYHLSTGTKLNYRLAQMHCRKVMVYHNITPPQFFEEYSVKAAQLCQNGLEGASYL
ADKVDYCLAVSEYNKQDLIRMGYTCPIDVLPILIPFDDYAKTPSQQVIDRYSDGYTNLIF
TGRIAPNKRQEDVIRAFYDYKKFYNPKSRLILVGGHNGMERYYHRLKSYINALELEDVVF
PGHIKFDEILAYYKIADVFLCQSEHEGFCVPLVEAMYFDVPVVAYDSSAIAGTLGGGGFL
LKDKNPVETAGVINRVVTDEALRTQIIKNQQARLADFDHKVIEAQFKTYLDTFINGGRKG

Enzyme Prediction     

No EC number prediction in MGYG000000562_00943.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	178	325	8.6e-29	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03817	GT4_UGDG-like	4.98e-28	42	291	65	312	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03801	GT4_PimA-like	9.20e-28	53	346	74	361	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	6.36e-27	51	357	73	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	2.88e-25	59	351	81	362	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
pfam00534	Glycos_transf_1	6.33e-24	178	329	5	154	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX91413.1	5.57e-158	1	360	1	360
QRP37264.1	1.12e-157	1	360	1	360
ASN97925.1	1.12e-157	1	360	1	360
QTE73647.1	1.34e-134	1	347	1	349
QTE72662.1	1.34e-134	1	347	1	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I45_A	5.17e-07	160	329	14	187	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]
6D9T_A	2.95e-06	178	359	219	396	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]
6N1X_A	3.75e-06	178	355	203	376	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU62	4.22e-12	51	303	93	342	Low-salt glycan biosynthesis hexosyltransferase Agl9 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl9 PE=3 SV=1
Q4JAK2	1.96e-07	120	310	130	311	Archaeal glycosylation protein 16 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=agl16 PE=3 SV=1
A7TZT2	7.53e-06	156	283	231	362	Mannosylfructose-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=mfpsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000562_00943.