CAZyme Information: MGYG000000561_01088

Basic Information

• Species: CAG-115 sp003507295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp003507295
• CAZyme ID: MGYG000000561_01088
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604	MGYG000000561_6|CGC2	68976.11	5.1174

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000561	2687682	MAG	China	Asia

• Gene Location: Start: 86447; End: 88261 Strand: -

Full Sequence      

MLNNVKNGSVKILPGVFRERMDVNRRYLMELDANCLLQNFYLEAGIILPGLQVVDDPTTA
NIHWGWEAPVCQLRGHFLGHWISAAAKLIASDGDAELKVKMDGIISELARCQELNGGEWV
GSIPEKYFTRLINNQYIWSPQYVMHKTIMGLSDAYIYTGNTLALDILSHLSDWYIRWTGR
AAETNPHAVYAGEEAGMLEVWAQLYQLTNDEKYLTLAKRYADAGLFRKLREGRDSLTNCH
ANASIPFTHGAARMYEITGDNDWLEVMKLFWKFAVTDRGMYSTTGMNAGEFWVPPHLQGH
FIGSNDQEFCTVYNMVRTASFLLRYTGEKQYADYIERALYNGFLAQQNADTGMPTYFLPL
AAGSRKKWGTKTRDFWCCHGTMVQAQTLYPEIIYYTGSERLIVSQYIPSRFEGEVSGHSV
TFEQTTGMKYYNDQAFFDEKDDGQMSRWLLKFSVKCADNAKFTISFRVPEWTVGAPEVEL
NGEKITAHVEDGYINITADWSDSTLQIFFPSELRMERLPDMPELGAVVDGPIVLAGLTSA
DCGIKGADKLPEQFMPQMEHTYGTFPWRQNSWRTRNQPQSVMFRPLYEIRDEEYTVYFTG
KDGE

Enzyme Prediction     

No EC number prediction in MGYG000000561_01088.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	10	535	1.8e-157	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	6.27e-117	9	535	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.22e-82	10	556	12	516	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	8.30e-05	189	339	408	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04792	LanM-like	1.55e-04	195	265	595	674	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
COG4225	YesR	3.48e-04	202	353	46	178	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL50077.1	5.52e-277	1	598	1	600
QTE68365.1	3.57e-267	1	599	1	600
QUA54004.1	1.50e-266	1	600	1	602
QTE71079.1	7.28e-264	1	601	1	600
QUC68168.1	4.18e-263	1	601	1	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.94e-61	9	604	32	654	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.10e-58	9	604	32	654	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	2.32e-21	81	533	82	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.20e-19	81	533	82	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	3.71e-11	81	533	81	564	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.03e-10	81	533	81	564	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000561_01088.