CAZyme Information: MGYG000000558_00126

Basic Information

• Species: Caecibacter hominis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Caecibacter; Caecibacter hominis
• CAZyme ID: MGYG000000558_00126
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191		22476.89	7.9663

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000558	2334569	MAG	China	Asia

• Gene Location: Start: 138761; End: 139336 Strand: +

Full Sequence      

MRRRNNTKVKIIIALCLASFSAMYFYSWKDDVMRKIVYPLQYDYMVRQYAYEDHVDPALV
AAVILVESKFNQSAASHRGASGLMQIMPDTGKWIAEEMGIKNFTPDQLNDVQTNIRMGTW
YLAYLLKEYDGNTVLALAAYNAGRGHVDEWMEKYGWDKNFEKIEEIPFTETREYVKMVLL
KRERYKALYNF

Enzyme Prediction     

No EC number prediction in MGYG000000558_00126.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	53	179	1e-31	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.44e-79	39	179	1	141	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.88e-63	38	188	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.31e-43	57	179	1	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.53e-37	10	190	98	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	3.23e-32	46	156	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB81730.1	7.49e-119	1	191	1	191
AXL22000.1	4.25e-109	1	191	1	191
ALG43012.1	4.53e-104	1	191	1	191
AVO73570.1	1.30e-103	1	191	1	191
AVO26251.1	1.30e-103	1	191	1	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.05e-23	34	190	404	560	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.06e-23	34	190	408	564	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.07e-23	34	190	414	570	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.07e-23	34	190	418	574	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.08e-23	34	190	424	580	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	9.89e-22	38	191	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	9.89e-22	38	191	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	1.16e-20	38	179	476	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	9.57e-20	55	178	73	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.18e-17	38	179	1418	1538	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.926513	0.030138	0.035311	0.000165	0.000116	0.007784

TMHMM  Annotations     

start	end
9	28