CAZyme Information: MGYG000000554_00961

Basic Information

• Species: Campylobacter fetus
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter fetus
• CAZyme ID: MGYG000000554_00961
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266		30929.02	8.7361

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000554	1538481	MAG	China	Asia

• Gene Location: Start: 5390; End: 6190 Strand: -

Full Sequence      

MPNNLNLFLAKFAFSNHIITISHYKNSSLFYLLSKNAKVIHHTKEDLTLKTYLKMLDLEL
FQNELQKDMIKVKKMVQKPLFIPEKYENLFINENKFKIGLSLSAGNKMKTIIPQTWDKIF
EILSKFDVEIYIFGVGDEINLLKNTDTKNIKIVSLVDKISLNELPFYISKMNLYISSDTG
NYYIADTMEVPTICFMGPCFASEQRGVFNSLIIKSNLPPFSAVFDTIYKADAKKYFEITQ
KDEKNIYEFINNLYKSFLSDKDSFPN

Enzyme Prediction     

No EC number prediction in MGYG000000554_00961.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.79e-07	95	198	120	224	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.10e-04	70	198	147	279	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	8.76e-04	116	198	126	211	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS04674.1	9.13e-189	1	266	107	372
QMS66461.1	9.13e-189	1	266	107	372
QMS68212.1	9.13e-189	1	266	107	372
QMS60530.1	5.27e-188	1	266	107	372
QMS62573.1	5.27e-188	1	266	107	372

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000554_00961.