CAZyme Information: MGYG000000553_01289

Basic Information

• Species: Prevotella sp900548535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548535
• CAZyme ID: MGYG000000553_01289
• CAZy Family: GT2
• CAZyme Description: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000000553_11|CGC1	45603.85	9.3102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000553	2921999	MAG	China	Asia

• Gene Location: Start: 70353; End: 71555 Strand: +

Full Sequence      

MESFFSQTWEDKEYIVIDGGSTDGTADIIKEYAPRLAYWCSEKDNGIYDAMNKGIIHATG
DWINILNCGDVYANNNVFSKIFSESDYQGISVVYGNSIEIKSGREYYTPAKEDYHKLSQM
VVYRHGSSFIRSSVQKNDLYNLELKKKLGYALDFEMIHRIYKKGHLFKKININIEKFQSE
GISAKPFRSIWYNYLIISGCKFKISTLPYLVKKMGFRLLSTSPFYKFAKALGIEFMVNDI
LPHIPFWRIRKAYLRLVGMHIGQDTYITKKNYIMSPWLINIGKYGHINRDCTLDGRGIIE
IGNSVSISHGVKLMTGSHDIQNCYFPGIYEKITIEDYAWLGVNCIILKGITIGKGAVVAA
GAVVTKNVPDYTIVAGIPAKPIGKRKEDLAYKCIWKELFT

Enzyme Prediction     

No EC number prediction in MGYG000000553_01289.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	2	113	6.1e-17	0.6705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06433	GT_2_WfgS_like	2.07e-53	1	183	17	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04647	LbH_MAT_like	4.65e-27	279	382	2	109	Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.
PRK10502	PRK10502	1.63e-24	235	387	25	180	putative acyl transferase; Provisional
cd05825	LbH_wcaF_like	9.93e-23	276	382	1	107	wcaF-like: This group is composed of the protein product of the E. coli wcaF gene and similar proteins. WcaF is part of the gene cluster responsible for the biosynthesis of the extracellular polysaccharide colanic acid. The wcaF protein is predicted to contain a left-handed parallel beta-helix (LbH) domain encoded by imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. Many are trimeric in their active forms.
COG0110	WbbJ	5.96e-22	224	388	12	181	Acetyltransferase (isoleucine patch superfamily) [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXV50072.1	4.22e-156	1	400	22	421
QUB91771.1	8.48e-156	1	400	22	421
QUI93290.1	1.70e-155	1	400	22	421
QJR60740.1	5.02e-56	1	204	22	225
QJR54460.1	5.02e-56	1	204	22	225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ECT_A	5.26e-13	250	387	48	188	CrystalStructure of the Hexapeptide-Repeat Containing-Acetyltransferase VCA0836 from Vibrio cholerae [Vibrio cholerae],3NZ2_A Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3NZ2_B Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3NZ2_C Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3NZ2_D Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3NZ2_E Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3NZ2_F Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3NZ2_G Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3NZ2_H Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3NZ2_I Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3NZ2_J Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3NZ2_K Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961],3NZ2_L Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor [Vibrio cholerae O1 biovar El Tor str. N16961]
4MZU_A	4.32e-12	287	383	31	148	Crystalstructure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217],4MZU_B Crystal structure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217],4MZU_C Crystal structure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217],4MZU_D Crystal structure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217],4MZU_E Crystal structure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217],4MZU_F Crystal structure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217],4MZU_G Crystal structure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217],4MZU_H Crystal structure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217],4MZU_I Crystal structure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217],4MZU_J Crystal structure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217],4MZU_K Crystal structure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217],4MZU_L Crystal structure of FdtD, a bifunctional ketoisomerase/N-acetyltransferase from Shewanella denitrificans [Shewanella denitrificans OS217]
1KQA_A	7.02e-12	250	382	47	182	GalactosideAcetyltransferase In Complex With Coenzyme A [Escherichia coli],1KQA_B Galactoside Acetyltransferase In Complex With Coenzyme A [Escherichia coli],1KQA_C Galactoside Acetyltransferase In Complex With Coenzyme A [Escherichia coli],1KRR_A Galactoside Acetyltransferase in Complex with Acetyl-Coenzyme A [Escherichia coli],1KRR_B Galactoside Acetyltransferase in Complex with Acetyl-Coenzyme A [Escherichia coli],1KRR_C Galactoside Acetyltransferase in Complex with Acetyl-Coenzyme A [Escherichia coli],1KRU_A Galactoside Acetyltransferase in Complex with IPTG and Coenzyme A [Escherichia coli],1KRU_B Galactoside Acetyltransferase in Complex with IPTG and Coenzyme A [Escherichia coli],1KRU_C Galactoside Acetyltransferase in Complex with IPTG and Coenzyme A [Escherichia coli],1KRV_A Galactoside Acetyltransferase in Complex with CoA and PNP-beta-Gal [Escherichia coli],1KRV_B Galactoside Acetyltransferase in Complex with CoA and PNP-beta-Gal [Escherichia coli],1KRV_C Galactoside Acetyltransferase in Complex with CoA and PNP-beta-Gal [Escherichia coli]
3FTT_A	1.64e-11	277	389	73	188	ChainA, Putative acetyltransferase SACOL2570 [Staphylococcus aureus subsp. aureus COL]
5U2K_A	3.02e-11	277	389	73	188	ChainA, Galactoside O-acetyltransferase [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71239	4.82e-18	13	184	35	202	Putative colanic acid biosynthesis glycosyl transferase WcaE OS=Escherichia coli (strain K12) OX=83333 GN=wcaE PE=4 SV=2
Q09707	1.05e-17	279	384	95	203	Putative acetyltransferase C18B11.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC18B11.09c PE=3 SV=2
Q86A05	7.23e-14	279	382	81	189	Putative acetyltransferase DDB_G0275507 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275507 PE=3 SV=1
P37515	2.34e-12	279	380	75	179	Probable maltose O-acetyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=maa PE=3 SV=1
P9WMX8	1.07e-11	13	159	37	183	Uncharacterized glycosyltransferase MT1564 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1564 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000553_01289.