CAZyme Information: MGYG000000551_01568

Basic Information

• Species: Mailhella sp900553065
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp900553065
• CAZyme ID: MGYG000000551_01568
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821	MGYG000000551_37|CGC1	93781.13	9.4972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000551	2226054	MAG	China	Asia

• Gene Location: Start: 17508; End: 19973 Strand: +

Full Sequence      

MKSYQDMDFRVRDRILLYARGLNLSPKESVELALESLKRCRSEHPSYDEALVCLHEILAE
KERELIPGDEAPHLMSAPGMTRSSMLAEELDRTPWLSIFKKTLSRLFRIFRPSGITARAS
WKDSADRQRRQLEWEKVAGRRRTLLMTLILVPAVIGAFLMYGILPQQGIETVKIITAVLF
AILFGWISIGFWMCVAGCWVLSRKVDRFTPTRGCDEVEIPETTRTAILFPVYNEDTRRYM
AGIAATWHSLVQSGESDKFDIFILSDSTSPDAWVAEEEAWYEFCNREQAFGHIFYRRRRN
NTKRKSGNVADFCRRWGAQYKYMIVFDADSVMSGRTMVRMVKSMELHPEMGMIQTPPLAV
NMNSLVARVQQFANHLYGPVFATGLHFWLLGDAQYWGHNAIIRVEPFIRHCQLPTLPGRG
PLAGDILSHDFVESALMRRAGYGVWLAYDLDGSWEESPPSLIDELIRDRRWCQGNLQHSR
LIFSGGIFPTHRALFINGIMSYASALLWLFFLIFSSIQAVTEAFIPPSYFPSGPTLFPIW
PTWYPKWALLLLGSTCIMLFMPKIFAIILTLRKGGAENFGGAGHMCMSVLAEVLISTLLA
PVRMLFHSFFVVTTLLGWKVSWNTQNRSDTGTAWSDAIRFHWWGTLIGLLWGGVMWLINP
GFFWWFSPIAVGLTLSIPLSVFTSRVSWGLAAKRMGLFITPSELKAAPEQADMHEVLAIP
DRYSPFTIERGRGFTRAVVIPRVHALHIALIRRRKWERPIGEEREKTRRALLAKALDKGP
FGLSKQEKSALLMDPRLLNELHRKVWELPPDKGHDWGVAQN

Enzyme Prediction     

No EC number prediction in MGYG000000551_01568.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2943	MdoH	0.0	121	816	44	729	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
PRK05454	PRK05454	0.0	124	698	24	599	glucans biosynthesis glucosyltransferase MdoH.
cd04191	Glucan_BSP_MdoH	1.53e-141	225	478	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
cd06423	CESA_like	2.75e-12	227	410	1	169	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06421	CESA_CelA_like	1.06e-11	226	478	4	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE57933.1	5.50e-257	131	818	7	697
ACU88715.1	8.92e-256	134	811	10	687
CBL27919.1	2.18e-253	134	818	11	686
AMD93486.1	1.37e-244	134	809	10	685
EGJ50009.1	6.99e-234	134	816	17	698

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9HUA6	3.76e-202	134	816	133	826	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=opgH PE=3 SV=1
B7V3H0	3.76e-202	134	816	133	826	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=opgH PE=3 SV=1
A6VDK0	1.45e-201	134	816	132	825	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=opgH PE=3 SV=1
Q02EU0	1.50e-201	134	816	133	826	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=opgH PE=3 SV=1
Q8XVC2	4.88e-200	73	806	126	841	Glucans biosynthesis glucosyltransferase H OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
143	165
180	202
498	520
547	569
640	658
662	684