CAZyme Information: MGYG000000546_01744

Basic Information

• Species: Roseburia sp003483745
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp003483745
• CAZyme ID: MGYG000000546_01744
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1061	MGYG000000546_77|CGC1	114786.82	9.9241

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000546	3035642	MAG	Fiji	Oceania

• Gene Location: Start: 9663; End: 12848 Strand: -

Full Sequence      

MDDKGQQQYADTEKFATVTKTPQLSQAKLTSVAAEGCNSLTLIWDKVEGADGYVVLRSEN
GKEYTQAADITDAKTTYVDASLTAGMVYSYKVQAYRNINGKKVYGEESGVLSGKPLPSAT
TLTAQSAGYKAIQLTWNAVDGVNGYAVYRKAAGKSGFDQIATVNADTTSYKDTKVTSGVS
YTYKVKAYKNVNGTQVWGDDSNEATAVPALQAPQVTLTNTTYNSVTVSWNKVSGAQGYNI
YRSTKPNSGFKVVKKVNNKSTVKFVDKKLSVGKTYYYQVCAFRAVGGKNAEGERSAVLSV
NAAPEGVKVKAVAAGATAVKLTWKTVTMPSTGGGYDIYQVTDGVDKKIKSCSKKKTSYTV
KNLTPGQSYTFKIVTYAKNKKGKAVSGGTSNILTTSPQLLPVAIDKVVSSDYNSVLVSWK
TTVAADEDGYLVYRATSKKGKYKKVGTVAKNNGEGNYSYNDTGVKLGKKYYYKVVATRNL
ADGNVMRSAYSAPMSVTAAPGITTVAIESAGNGSLKLTWKKVKTSEHGYVKGYAIYRSTT
EKGKYKKIKTINKGTTDSYVDKGLTTGNTYYYKVRTFCKSGGKTIYSADSEIVSMQVKPD
LTSIQVVAANYNTITVSWQKIDGCSGYTVYRSAQADGKYKAVKTLSSANKLSYKDTGLST
GQTYYYKVRAYVKKGGKKIYGEYSGVKNATPVLGKPTGLYATSVDNNQIKLTWDAVAGAE
TYTVLRSTSEHGKYKIATEICSTNSYVDVNVAVGKTYYYKVYAVRGEFVSETTDCVSVVS
ASIELSTTSVVIKTGTSVKITATVKPAGVIAWTSSDSKIAVVSSDGTIYGIKAGSTTVKA
TVNGITKSISVTVKDKLETENKTIDISSDNGTIDFNAVKAAGYECVMLRISRGTTEDANF
KTNYKNAKAAGLKVGGYCYALAQNAAQAKSEGDKVLSIVGGQKLDYPIVYMMEDESLLYN
NLNKTQRNELVYAFRKEIIEAGKQYSFALGISQTMLEKYPDKYLDTSQFTGMDLWITNYR
AENLGSGYQGKGNVIMWRYTQQGTVSGVNGKVNISIRYKNY

Enzyme Prediction     

No EC number prediction in MGYG000000546_01744.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	864	1048	3.7e-37	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	2.82e-39	862	1058	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	2.97e-26	864	1056	3	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	1.06e-20	862	1054	1	181	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	4.23e-17	864	1048	1	180	Glycosyl hydrolases family 25.
COG3757	Acm	9.09e-15	859	1054	61	250	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL14028.1	0.0	5	1061	340	1396
VCV23482.1	0.0	5	1061	340	1396
QUO20801.1	3.72e-95	75	1061	174	1060
VCV20908.1	3.20e-80	39	765	562	1271
CBL07763.1	6.98e-76	14	765	533	1265

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3MPC_A	1.23e-09	696	764	8	77	ChainA, Fn3-like protein [Acetivibrio thermocellus ATCC 27405],3MPC_B Chain B, Fn3-like protein [Acetivibrio thermocellus ATCC 27405]
5G56_A	9.25e-08	696	764	620	689	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P34020	3.63e-11	862	1054	2	177	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
Q02388	1.09e-06	101	767	213	850	Collagen alpha-1(VII) chain OS=Homo sapiens OX=9606 GN=COL7A1 PE=1 SV=2
P50899	2.78e-06	599	800	798	992	Exoglucanase B OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000546_01744.