CAZyme Information: MGYG000000546_00547

Basic Information

• Species: Roseburia sp003483745
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp003483745
• CAZyme ID: MGYG000000546_00547
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000000546_13|CGC1	36315.53	9.5007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000546	3035642	MAG	Fiji	Oceania

• Gene Location: Start: 20546; End: 21526 Strand: -

Full Sequence      

MELVKHMPHIFGMLYKAGMAISNSKHKSPVYYANALMAKKLAAYLKQHDYDVIVTPHLYP
AETMTYMKKKGMLKIPAIAIGTDYTCIPFWEETNLDAYFLPHEDCVAEYVHRGIPAGKLY
PYGIPVGEAFSPSGDRILAKVLARDSLNLPQDIPICLVMSGSMGFGKLAIFAAELSLRLK
SGEHIVIICGSNKRIYNVLQKQFQNNPRVHILGYTNRVADYMDACDVIFTKPGGLTSTEA
LVKRIPIVHTAPIPGCETANRNFFVKRHLSVSSKYIAKQITLGKRLLSDSPDTHGNSSLR
EEMLLAQKENGKPDAAIHIIKKLEKL

Enzyme Prediction     

No EC number prediction in MGYG000000546_00547.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	157	315	1.2e-22	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	5.61e-58	2	326	54	361	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PLN02605	PLN02605	5.92e-33	3	326	57	378	monogalactosyldiacylglycerol synthase
PRK13608	PRK13608	1.11e-31	59	267	112	316	diacylglycerol glucosyltransferase; Provisional
PRK13609	PRK13609	1.95e-30	6	321	64	363	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	5.72e-22	27	326	71	354	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV23455.1	1.60e-218	2	326	55	379
CBL08784.1	1.87e-217	2	326	55	379
CBL14051.1	1.87e-217	2	326	55	379
ACR75748.1	1.79e-140	3	326	71	383
ABX42261.1	3.32e-116	2	323	55	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	2.27e-22	26	278	84	344	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L524	2.38e-28	40	264	95	313	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=ugtP PE=3 SV=1
Q8CPR3	2.28e-27	59	264	112	313	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=ugtP PE=3 SV=1
Q5HQE7	4.35e-27	59	264	112	313	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=ugtP PE=3 SV=1
B9DQ98	1.14e-26	59	289	112	338	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus carnosus (strain TM300) OX=396513 GN=ugtP PE=3 SV=1
Q49WE6	7.83e-26	40	267	95	316	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000546_00547.