CAZyme Information: MGYG000000542_00082

Basic Information

• Species: UBA2883 sp900768915
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA2883; UBA2883 sp900768915
• CAZyme ID: MGYG000000542_00082
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708		78667.65	9.209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000542	1922508	MAG	Fiji	Oceania

• Gene Location: Start: 90742; End: 92868 Strand: +

Full Sequence      

MSRYNKRGYDDFRTRVSRRSYEEEDTIFDTFKRLIILGAAICLGGLVSLQAYLMMVPPIA
NLSDFRPNMVTTFYSSDGEVIKTFNACTFSKVSISDVPKQLQQAVIATEDKNFYNHHGYD
LLGLSRSMIENVIAGHVVQGGSTITQQLSRMLFLSNEQTYSRKLKEIIIAAKIEKSLSKD
QILEMYLNNVYLGSGAYGVDGAAQTYFNKKLNQLTLGEMALIAGLPQAPSVYSPFNNPDL
AKKRRNKVLERMYKMNYIDKATMESAQAEQIHLTSVPKYYTLNKAPYFCDYVMRELARLG
FTEQEITSGGYKIITTLDYKAQLKANEALVRDLNAWGLSGAKNQAAIFSFSPVDGKILVY
AGGKNYAESQYDRVTQAIRPPGSAFKPFIYTAAIQKGLTPNDMIDDTPYRLGNWAPHNYG
NKYRGRIPLYKALMISSNVCAVRLIEYVGVRAVIQVARVMGINTPLQYDYTIALGSNGVK
LFELTRAYGIFASGGYKVEPYAIERVESSRGKILYSAPRARVEKVLETDVAAAMTSMLKM
VIKHGTGMAANIGKPCAGKTGTTDDYKDAWFVGYTPSVVTGVWVGNDDNTKMGGLTGGTV
PAIIFRDVMRQATEPFGNEDFGYPDMLATKSGGRTVSQLTSPNVSPTKYRDDTDETAPTE
DVVHVNSYQPQMNERVLNSQQNTQTQNRNAIPQTTHPPIPTAGQDFNY

Enzyme Prediction     

No EC number prediction in MGYG000000542_00082.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	77	253	9.5e-70	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	0.0	92	614	5	530	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	0.0	27	684	8	791	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	0.0	31	670	15	655	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	2.98e-117	62	613	126	683	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
TIGR02073	PBP_1c	2.19e-111	91	616	35	549	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38680.1	1.11e-306	13	700	17	706
QUY41518.1	1.67e-151	42	632	142	727
AEE14353.1	2.42e-150	56	612	35	592
ACK42407.1	3.95e-150	56	623	49	620
ACI19842.1	1.01e-149	43	623	36	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UDF_A	2.62e-104	74	614	24	717	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
4OON_A	1.18e-103	74	600	24	710	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	1.28e-75	56	517	7	566	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
5FGZ_A	3.21e-70	67	597	142	681	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3ZG8_B	3.28e-70	172	596	2	442	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	1.49e-106	32	624	2	679	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q9ZCE9	3.66e-104	56	639	34	743	Penicillin-binding protein 1A OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=mrcA PE=3 SV=1
Q07806	1.58e-103	56	600	33	737	Penicillin-binding protein 1A OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mrcA PE=1 SV=2
Q68VU2	2.62e-103	56	639	34	743	Penicillin-binding protein 1A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=mrcA PE=3 SV=1
Q4UK08	1.57e-102	56	640	34	744	Penicillin-binding protein 1A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999996	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
34	56