CAZyme Information: MGYG000000542_00045

Basic Information

• Species: UBA2883 sp900768915
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA2883; UBA2883 sp900768915
• CAZyme ID: MGYG000000542_00045
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449		52184	8.3985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000542	1922508	MAG	Fiji	Oceania

• Gene Location: Start: 41282; End: 42631 Strand: +

Full Sequence      

MRERILLFSILLALLAFLYVFQNYVNTIFGLIILLCFMTLYGVYTSLALTHKKRKLKKQP
IVINENYKPFVSIMIPAHNEESVIAHTVENIRNLTYKNIEIILIDDRSEDNTLEVIKSLA
DKFDNVKYLSRKKDAFPGKSAVLNDALVIAQGEAILVFDADATVEPDFLSKLVPNLEPED
VGAVQARKVIRNSDTNILTKCQNNEYTLDTYLQVGRDAIKGAVELRGNGELIKRKALEDI
GGWNNYTITDDLDMSTRLHIKGWDVRYCLDAKVYEEGVCYIIPLFRQRRRWLEGTIRRYL
EYFFQAISSKKMSLKAKLDMVVYITQFIMPLWFLFEIIIRSFKVLTYRVGIPNEIMSSAI
ISFAVAFGFFFAIRYSLRRYDNMKRWEAFVQASYTALYMLIIWFPMVLFICGKILFCKKD
MNWGKTTHGLIVEEEQNIENSQEKDLHEV

Enzyme Prediction     

No EC number prediction in MGYG000000542_00045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	69	292	5e-38	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	1.01e-59	17	438	1	434	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.11e-52	73	251	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	1.14e-42	36	407	19	384	N-glycosyltransferase; Provisional
cd06437	CESA_CaSu_A2	3.65e-39	69	294	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06439	CESA_like_1	4.54e-37	54	297	14	250	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38294.1	3.58e-192	46	438	2	393
BAZ42219.1	3.35e-73	48	428	88	465
BDA68096.1	3.18e-69	39	330	80	369
BAZ61295.1	6.27e-69	30	330	71	369
BAZ15148.1	6.27e-69	30	330	71	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.60e-11	69	300	128	380	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.68e-11	69	300	140	392	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.68e-11	69	300	141	393	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	2.68e-09	56	297	258	503	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
3BCV_A	1.91e-08	69	167	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3MB01	1.51e-66	30	428	71	463	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	5.86e-66	69	428	106	463	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
P74165	4.68e-56	69	441	108	479	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
P96587	2.86e-27	65	305	43	293	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q5HKQ0	5.91e-24	37	314	13	290	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	22
27	49
320	339
354	373
394	416