CAZyme Information: MGYG000000538_01879

Basic Information

• Species: UBA1829 sp900549045
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549045
• CAZyme ID: MGYG000000538_01879
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000000538_9|CGC3	40015.51	9.921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000538	3384359	MAG	Fiji	Oceania

• Gene Location: Start: 95802; End: 96935 Strand: -

Full Sequence      

MKLTALAISCGGTGGHFNPGLSIARALKARGGKPVLILGGKHVVKQAETAAEYGIEAVRI
EAVPLTKNPFRLPMFFKHLFAGAAQTKAAYRKYGCQALLCMGSFASFPPALAARLNRFPL
FLHDGNAKIGRANRMLSRWAKALALSFPVKDVSRCKCPTILTGMPLRPEIVSGVMDKADA
VAEINRRWNAGFSPEKPLLLVFGGSLGARTINTKVKIPVGLPGANDLQVVRLVGPGNLEA
IRPLYAASPAKELILEACQDMNILYSAADLVICRSGGSTVSELAIYGKYAVLSPFPFAAD
GHQDDNAQWLAAAGGANVVADGDCTEEKFASILRTWTANRAEFTTRGAGSKRLAQPDAAG
NVLDMIENILSVSPQSV

Enzyme Prediction     

No EC number prediction in MGYG000000538_01879.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	199	358	2.6e-39	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.06e-88	6	370	4	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	9.60e-83	6	365	2	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	5.64e-75	6	369	3	354	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	2.53e-64	6	366	3	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	1.14e-25	198	359	1	163	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH42448.1	6.72e-102	2	370	7	374
AVM45852.1	1.61e-89	1	374	1	376
QTN34230.1	1.07e-56	1	368	1	359
QUE51483.1	2.07e-53	2	370	3	362
QJE95525.1	5.89e-53	1	371	1	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	2.46e-38	12	369	18	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	2.37e-31	8	364	7	349	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	5.08e-27	6	369	9	353	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01Q48	5.93e-48	11	369	19	358	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=murG PE=3 SV=1
Q728U8	9.14e-48	8	376	6	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=murG PE=3 SV=1
A1VBE8	1.28e-47	8	376	6	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) OX=391774 GN=murG PE=3 SV=1
Q3A2G6	1.28e-44	6	369	3	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=murG PE=3 SV=1
B9JH51	1.83e-44	1	369	1	360	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999955	0.000090	0.000004	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000538_01879.