CAZyme Information: MGYG000000526_02326

Basic Information

• Species: Prevotella sp900770395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770395
• CAZyme ID: MGYG000000526_02326
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000000526_16|CGC2	41434.5	7.6149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000526	3510035	MAG	Fiji	Oceania

• Gene Location: Start: 42758; End: 43840 Strand: +

Full Sequence      

MKNIMKFAVGAAMALLVLPAMAAKGTPREQLLNRLQKLQKRGVMMGMQDAPVYGTTWKWD
EGRCDMKEVCGDYPAVMGFDLGKLELDSKENLDGVPFDRIRKEVRLQHERGGVVTISWHP
WNPATGENAWDPNGDAVVASLPGGAQNAKFHSWVVKVADFLKSLKTTGGKAVPVIFRPWH
EMTGGWFWWGCNSCTPEQYKQLFRYTIDILKEEGVTNCVWSYSPGADSKETVERYMRYYP
GDEYVDMLGVDIYRYGTHDQFMNNIRLECEIMRKEARDRNKLYAITETGYRNTPQSDWFT
AAVLPIMLEFDMSYVLLWRNAWDQKEENFAPAPDKECAADFRKLYNHKRTLFAKDIKTIK

Enzyme Prediction     

No EC number prediction in MGYG000000526_02326.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	29	351	5.4e-66	0.9537953795379538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.28e-36	29	253	10	230	Glycosyl hydrolase family 26.
COG4124	ManB2	9.14e-21	116	290	133	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB47762.1	1.97e-150	1	358	5	362
QUB41950.1	4.04e-147	12	352	9	352
QUB69107.1	9.39e-146	12	352	9	352
QNT67784.1	8.48e-145	26	360	29	367
QUB93961.1	2.20e-141	12	352	9	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	3.51e-101	31	355	15	338	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	1.18e-65	31	356	45	391	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	1.18e-65	31	356	45	391	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	2.16e-65	31	356	68	414	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	9.23e-65	31	356	45	391	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	1.39e-49	35	359	65	414	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.29e-35	31	289	54	318	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	2.51e-21	66	322	79	328	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	4.59e-21	33	253	50	266	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
P49425	1.24e-19	66	289	189	408	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000380	0.998890	0.000176	0.000196	0.000180	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000526_02326.