CAZyme Information: MGYG000000526_01286

Basic Information

• Species: Prevotella sp900770395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770395
• CAZyme ID: MGYG000000526_01286
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	MGYG000000526_6|CGC3	26955.6	10.5362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000526	3510035	MAG	Fiji	Oceania

• Gene Location: Start: 112840; End: 113544 Strand: +

Full Sequence      

MVFSLIKRIIRWIVVAFFASTIFSVVVLKFIPVYFTPLMFIRVAQQIKDGKDVRLYHHWV
SLDKISPSLPVAVMASEDARFLEHHGFDYKAIESAAKHNLKKKSKTKHGASTISQQTAKN
VFLWPGRSWVRKGFEVYFTALIEMMWSKQRIMEVYLNSIEMGEGIYGASAVAEHHFNTTA
DKLSRPQCAMIAVSLPNPRKFNSAFPSSYMFRRQSKILHEMKFVKAFPKEGEDK

Enzyme Prediction     

No EC number prediction in MGYG000000526_01286.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	56	222	5.1e-52	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.64e-114	3	234	5	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	6.42e-84	3	224	1	221	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.06e-66	1	222	20	241	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	2.42e-66	56	222	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	7.96e-36	6	221	1	230	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81082.1	5.30e-118	7	224	5	222
ALO48142.1	2.07e-114	6	233	4	229
ADE82296.1	2.59e-113	17	224	3	210
QNT65514.1	3.41e-113	1	233	1	231
QUB46829.1	2.66e-110	6	233	4	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.73e-23	59	221	22	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.43e-23	59	221	22	183	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3UDF_A	1.32e-20	60	221	42	202	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
3VMQ_A	1.27e-19	31	222	48	244	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMQ_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMR_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
5ZZK_A	1.33e-19	38	222	38	227	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A8H2	2.13e-92	6	228	7	230	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=mtgA PE=3 SV=1
Q3V815	4.38e-87	8	234	8	232	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=mtgA PE=3 SV=1
Q3V7G2	4.38e-87	8	234	8	232	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=mtgA PE=3 SV=1
Q3V7R3	1.33e-66	11	232	10	230	Biosynthetic peptidoglycan transglycosylase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) OX=264462 GN=mtgA PE=3 SV=1
Q4ZM52	7.33e-63	4	222	4	219	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35