CAZyme Information: MGYG000000526_00244

Basic Information

• Species: Prevotella sp900770395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770395
• CAZyme ID: MGYG000000526_00244
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1039	MGYG000000526_1|CGC7	116825.65	5.3063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000526	3510035	MAG	Fiji	Oceania

• Gene Location: Start: 323660; End: 326779 Strand: -

Full Sequence      

MMLLMCITMAGQQRRPIDSRHPIWFVHIDVWNQADPQKIIDLIPDDIKPYVCMNLSMSCQ
FDEAKGVYKMPQDAVQTYKSWATVCQHNGLWFMCQPASGGKTHILDSDMTTFEYFFKHYP
NFLGWNYCEQFWGFDESDRNSATQTDRIALFARLVEMSHNYGGFLTVSFCGNIWSHALTP
NGMLKRNAQLLEACKKYPEACIWLDKYTTTSCFYDTESVCMSPFISGLATNYGVRYDNCG
WNGAMDVLFGEGHGMKYPVSAGLTTVMEQTCVNGGSVWDGPELITYACFTSKPTTTVDGF
TRRNWERFPELTNGWIDMFRKIIDGSLYIPTREEVVGRTKIAVIADQGWNLEPSPDISVN
ENRYVAWGSLYDNVYKQDDPFNKGNGQWHDNMTFFKKTGRYASIPVCIDMYDDLSKSIPL
QVKKSQRTSVWQTEADKQKSFNDLYPEVSKGDLYVSRFKNQLITYTPYSYLNVKKTAKGV
IPLEYNTCSEMELTLGKLSNAAVREYADHIDFYMNNYRCDTLDNVLDKIVIKGATSKPSF
NMTKRAAATAEASDEWDAANATYTLNISHNGPVDITVNCSGNATGRATDVLPSASLAADL
PKQPGTYSGPITIEAEDMDYRNIRACVVEPYYQRESVRGHSGNGFVETGVSKAAQLRHKL
SLKQGGDYDIIIKYCSTQKSGTLDVEINGTRQQAEIEKTEKNQWKKVSVPAKLNAGENTL
YLKNTAGIFLYLDYVTYQPKGTAKETFTVTVEEAEHGIATANKTTAAEGDIITFDIKADE
GYEFVGWEFHPRQHPYFSDNTMQMPNDNVILKPLFKSSDILNAVYHLDFTNVVDGAMPEG
WKTVQGGNEEHEYPNTYSSGARTFAGFTGYQGKGLYWRENCAEYGRSENENYLLHLQPGK
YKLIYAMAAWKGEPTYSVSVTNAYTLEEMASSETLTARPNANGNKKADLSSAELRTMEFE
VNEEDDFVITFKTGGFNELLLLECMVSSVSGTGIEGIVPNVVDGEAAIYGVDGIKRNALR
KGINIVKMKNGETKKIFIK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	12	327	2e-84	0.9877675840978594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	9.05e-86	12	327	6	328	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
cd04083	CBM35_Lmo2446-like	3.98e-09	639	737	22	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04086	CBM35_mannanase-like	7.16e-07	636	736	18	117	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
cd02795	CBM6-CBM35-CBM36_like	6.24e-04	612	736	1	123	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.
pfam18998	Flg_new_2	0.002	747	817	1	72	Divergent InlB B-repeat domain. This family of domains are found in bacterial cell surface proteins. They are often found in tandem array. This domain is closely related to pfam09479.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29515.1	0.0	1	1038	10	1034
QNL40606.1	1.72e-168	9	738	221	932
QUT78600.1	8.96e-166	10	740	224	939
QUT26887.1	8.96e-166	10	740	224	939
QDH54066.1	8.96e-166	10	740	224	939

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMH_A	6.96e-16	41	577	64	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 in complex with the H- disaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998459	0.001603	0.000003	0.000002	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000526_00244.