CAZyme Information: MGYG000000525_00459

Basic Information

• Species: Duodenibacillus sp900767875
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Duodenibacillus; Duodenibacillus sp900767875
• CAZyme ID: MGYG000000525_00459
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524	MGYG000000525_6|CGC1	56401.61	4.9836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000525	1915990	MAG	Fiji	Oceania

• Gene Location: Start: 14904; End: 16478 Strand: -

Full Sequence      

MFKFSRSMRAASLAALTALSLPAAQAWDKWDAFKAANVNEGFRVVDYSDSRRITTSEGQS
YALFFALVAGDKASFEKLLKWTEDNLAAGDITKHKPAWLWGKGASGWGILDDNNAADSDM
WIAYDLLEAGRLWNRPDYTAKAKAMMTLLKKDVRDVEGLGKVILPGYKGFEQKNFVTLNP
SYYPVFILRRFAQEDPEWNAVIEGTVRALVRSSPRGFAPDWVRFDLQGKMMAEKGDDYTL
GSYNAIRTYMWAAMMSQDDPVRGILTERYAPFAKLTAQNGMPPETINIHTGKGIGTGSTG
FAACVLELLGPGAAQNYLRTVVENDPIVAENYYRNTLLVYAIGFDRGLYSFDRNGYLTIS
DKATLTKIAPKAAPEPAAKPAEEQAPAEEPVDETVEADKSEAADPAKEAAKAEPKAQAKT
EPKAEVKTQAQPEAKSEAKPEAKTDTQPAPAPAAAPAAQPRKAEGQPEVSVELKGEEPAK
DKAAAKPADEPAVKAPVEGAADGAACAAPASGAAPAAATEGSRP

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	27	341	5e-76	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	2.46e-138	26	357	24	364	cellulase.
COG3405	BcsZ	1.52e-78	27	351	26	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	1.35e-52	30	347	8	321	Glycosyl hydrolases family 8.
pfam15623	CT47	1.96e-04	385	444	193	250	Cancer/testis gene family 47. CT47 is a family of proteins found in eukaryotes. Proteins in this family are typically between 262 and 291 amino acids in length. There is a conserved HIL sequence motif. The function of this family is not known.
PRK09510	tolA	0.001	396	443	166	216	cell envelope integrity inner membrane protein TolA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53874.1	7.95e-129	33	359	30	360
QQS88762.1	3.44e-125	32	359	33	361
ANU67169.1	8.46e-100	33	359	28	350
QQQ96024.1	8.46e-100	33	359	28	350
ATP44700.1	2.15e-92	33	357	32	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2B_A	2.38e-89	33	357	10	339	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
7F81_A	1.30e-82	33	357	14	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	3.64e-82	33	357	14	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXQ_A	2.28e-81	33	357	10	335	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
5CD2_A	2.96e-80	32	358	31	364	Thecrystal structure of endo-1,4-D-glucanase from Vibrio fischeri ES114 [Aliivibrio fischeri ES114]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8Z289	2.22e-82	33	357	32	357	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
Q8X5L9	4.27e-82	33	357	31	356	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
Q8ZLB7	1.73e-81	33	357	32	357	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
P37651	6.62e-81	33	357	31	356	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	2.47e-70	32	357	38	371	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000990	0.997860	0.000288	0.000341	0.000277	0.000235

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000525_00459.