CAZyme Information: MGYG000000516_00024

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS902
• CAZyme ID: MGYG000000516_00024
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000000516_1|CGC1	28133.3	8.2029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000516	1853543	MAG	Fiji	Oceania

• Gene Location: Start: 27959; End: 28699 Strand: -

Full Sequence      

MCIPKIIHYCWFGGSPLPPSAKKCIESWKKKCPDYTIVRWDESNVDLDENRYASEAYKAG
KWAFVSDYVRLKVVYEHGGVYLDTDVELLKSLDALTGKYDGFFGYEWGKDLVATGLGFGA
VPGNRFVKAMLDGYDGISFFGADGKPDTTPCPERNTASLRALGVDPARRDQVIDNVCFLR
EEVLCPINFFIGKKKITKDTISIHHYDASWCSDVTRRTLRLKRIIGIRAYCFLYGKLLYR
SDRWEW

Enzyme Prediction     

No EC number prediction in MGYG000000516_00024.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	96	7.7e-23	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.04e-23	3	132	82	212	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	8.30e-17	18	102	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	7.65e-12	2	132	45	186	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.004	50	85	158	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANJ24018.1	2.70e-79	3	239	2	236
QUO31225.1	1.94e-78	3	226	2	225
ACD37145.1	8.83e-75	3	238	2	231
QGH87046.1	8.83e-75	3	238	2	231
BAQ02241.1	8.83e-75	3	238	2	231

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000516_00024.