CAZyme Information: MGYG000000514_00441

Basic Information

• Species: CAG-590 sp900769115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp900769115
• CAZyme ID: MGYG000000514_00441
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000000514_5|CGC2	39548.7	4.8654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000514	3147233	MAG	Fiji	Oceania

• Gene Location: Start: 48090; End: 49115 Strand: -

Full Sequence      

MKLECGINLGGYLSQCEHSMKHYVTFIQESDLRQIARWGFDHVRLPIDYEVLEDEEGNTL
EEGYAVIKGVLEWSKLYELNVVLDLHKAYGYDFNDAGNNEKNNLFSNESLQQRFLNLWAQ
IAVHFGRYDNVAFELLNEVVEKENAQAWNNLIRKTVTTIRQITNDTPVIYGGIQWNSVKT
LKLLEVPMDSNTIFTFHFYEPLLFTHQKAHWVETMDKNKTIVYPGQMQDYRKESEVLGYQ
GEVVIKSHSNTMGEEFIREMVQEAVQAAANAGVGLYCGEFGVIDQAPLIDTLRWFKDVNT
VFRENHIGCAVWNYKGMDFGFVDDHYSLIRGKLLDLWTDRK

Enzyme Prediction     

EC	3.2.1.-	3.2.1.4	3.2.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	6	319	8e-132	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.71e-25	26	318	24	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.33e-19	6	178	54	234	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02456.1	6.04e-169	1	338	1	338
AEV59731.1	6.90e-166	1	340	2	341
AEV59739.1	1.41e-155	1	337	1	337
QQA00641.1	1.38e-148	1	337	1	337
AEB15411.1	5.71e-131	1	339	1	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	3.53e-77	1	341	2	342	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	9.97e-77	1	341	2	342	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
7EC9_A	2.75e-30	28	323	38	314	ChainA, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
1VJZ_A	1.41e-29	28	323	38	314	Crystalstructure of Endoglucanase (TM1752) from Thermotoga maritima at 2.05 A resolution [Thermotoga maritima]
3AMC_A	7.28e-23	6	323	15	296	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23340	1.37e-76	1	341	2	342	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	1.37e-76	1	341	2	342	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P0C2S3	2.73e-76	1	341	2	342	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	1.58e-70	6	307	10	286	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P14250	1.11e-22	3	335	310	647	Endoglucanase 3 OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) OX=59374 GN=cel-3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000514_00441.