CAZyme Information: MGYG000000513_01774

Basic Information

• Species: Helicobacter_B fennelliae
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_B; Helicobacter_B fennelliae
• CAZyme ID: MGYG000000513_01774
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412	MGYG000000513_43|CGC1	46250.95	10.024

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000513	1869856	MAG	Fiji	Oceania

• Gene Location: Start: 2303; End: 3541 Strand: +

Full Sequence      

MIGFYLLGQSDCDNPNAISKQQLQLWEQEGIITYLGQSDDVRPFIMQSLCVVLPSFYKEG
VPRILLEAMSMGKPIITANVAGCKECVAPPSKRIQNFLVGQNGILIAPKDRQALSQAMQY
IQNLSLSQIKQMGKNGRAYAMSRFCISRIIQSYQCVVKNLKQSQNNPPNQAIAFVSNTCY
GMYNFRLQVMRAFYRDGFEIHILAPLDSSSKALKREGFRLHHIDIDSKGLNPLKDIKSAY
QIYVALKNIKPKIVFNYTIKPAIYGSFVANTLKLPNIAVITGLGYVFVSGGWKKRILRAL
VCGMYRVALFKTTQVWFLNPDDKAEFLQYKNISSHKARLLDSEGVDTTFFSPQVSLPPIQ
NLNCNQTPQHKEIIFLLVARMLWDKGVGEFVEAARMIKKSNTATSSGGGGKY

Enzyme Prediction     

No EC number prediction in MGYG000000513_01774.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03808	GT4_CapM-like	4.69e-61	172	401	2	218	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03808	GT4_CapM-like	7.53e-36	4	153	223	357	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
pfam13692	Glyco_trans_1_4	3.75e-19	32	121	58	135	Glycosyl transferases group 1.
cd03801	GT4_PimA-like	1.30e-17	4	153	226	361	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03807	GT4_WbnK-like	7.41e-15	29	154	246	358	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOQ96447.1	1.03e-136	4	409	13	568
QOQ90278.1	2.39e-135	4	410	13	569
BAM31566.1	4.67e-135	4	409	13	568
VEJ24448.1	4.62e-129	2	395	3	377
BBT96042.1	9.74e-53	172	401	8	222

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0P9C9	5.69e-21	172	408	3	239	N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000513_01774.