CAZyme Information: MGYG000000512_00227

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000000512_00227
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221	MGYG000000512_2|CGC1	25858.51	8.0173

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000512	1575087	MAG	Fiji	Oceania

• Gene Location: Start: 12452; End: 13117 Strand: -

Full Sequence      

MNEQNYEKAYDPIAARERRAAREKQRIRKQQRRRRRLLRLVSLFLVVIVAVCAVPPLCNR
AEQFLYPRKYEQLVEKWATAYELDPLLVYAFIRTESGFDPQATSSVDARGLMQMTEETFL
WMRSKIAPEEPLTFADLYNPDTAIRFGCYYLHLCMERYKGDVSTAAAAYHSGWGTVDQLL
QMEEHSADGETLQGFPYNQMHHYVNKITACYQTYQRLYAGQ

Enzyme Prediction     

No EC number prediction in MGYG000000512_00227.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	83	215	1.2e-28	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.23e-54	67	212	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.43e-35	65	217	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.23e-28	85	212	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.46e-25	76	176	3	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	8.27e-23	66	220	135	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB28497.1	8.03e-131	1	221	1	221
AXA80758.1	9.95e-98	39	220	13	194
CBK98413.1	2.85e-97	39	220	13	194
ATL89088.1	5.51e-91	40	220	8	187
ATO98725.1	2.60e-89	40	220	8	187

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	4.64e-09	66	220	449	603	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	8.44e-09	66	220	449	603	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5MPQ_A	1.11e-08	66	220	412	561	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.12e-08	66	220	416	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.12e-08	66	220	426	575	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.26e-12	71	211	61	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	4.18e-11	66	211	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	4.18e-11	66	211	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
A8GJ50	2.70e-08	69	216	190	357	Membrane-bound lytic murein transglycosylase C OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltC PE=3 SV=1
B2K0V2	3.65e-08	69	216	190	357	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998218	0.001604	0.000067	0.000009	0.000005	0.000097

TMHMM  Annotations     

start	end
37	59