CAZyme Information: MGYG000000509_01121

Basic Information

• Species: CADBRU01 sp900762815
• Lineage: Bacteria; Elusimicrobiota; Elusimicrobia; Elusimicrobiales; Elusimicrobiaceae; CADBRU01; CADBRU01 sp900762815
• CAZyme ID: MGYG000000509_01121
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000000509_14|CGC1	42930.52	10.05

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000509	1316319	MAG	Fiji	Oceania

• Gene Location: Start: 32645; End: 33799 Strand: -

Full Sequence      

MPTITPLQRNILIVAGDVSGDLHASGLMRELKAADPALKITAIGGPLMQQQADTFLYDLA
SQGASGFIEPLKKMPLWIRLMKQIRAYMETQNPSAVIVVDFYGFNHQVLGMAAHRHIPAY
YYVTPQVWASRQYRAKQLARLTQKMFVIYPFETEFHKKFGGNAVFLGNPLLDIMPLPQPH
TPETGDVKTKAWKLGLLPGSRQGEISRLAPVFYQAFKQVLKEFPNTQAYLFMLPDRDEKE
VLSLLGETPHANFHLVKDKNYELRSQMDFLLACSGTATLENALLGVPMVVAYKMFWPTYQ
IAKMVIKVKYISLVNLLAGKPVVKELIQGFATPRALAAEVMAMFQNPAKLAAQRDELLKL
RASLGEKGVAARAAKEILSDIVKK

Enzyme Prediction     

No EC number prediction in MGYG000000509_01121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	11	365	1.6e-105	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.09e-113	11	378	4	372	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.15e-104	11	378	4	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.10e-81	11	382	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.49e-75	11	378	8	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.93e-49	11	377	4	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACC99056.1	4.60e-154	1	381	1	374
AMM42216.1	2.16e-72	11	375	3	359
QJB55139.1	5.09e-72	16	381	15	374
ACS79052.1	5.91e-70	4	381	1	372
CCO23940.1	1.66e-69	4	381	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.53e-44	11	360	9	361	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.53e-44	11	360	9	361	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	2.80e-67	11	383	6	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	1.75e-65	8	384	6	383	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2IL69	4.75e-65	7	378	7	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B3E4H8	9.42e-65	9	381	7	380	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q1D393	1.87e-64	11	378	7	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000509_01121.