CAZyme Information: MGYG000000504_01753

Basic Information

• Species: CAG-312 sp000438015
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp000438015
• CAZyme ID: MGYG000000504_01753
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	MGYG000000504_19|CGC1	44685.85	7.6873

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000504	2519783	MAG	Fiji	Oceania

• Gene Location: Start: 30416; End: 31606 Strand: -

Full Sequence      

MMKKTLFLFFAASALASGLFAETTSALIDSTMKTCKAQALGMLKNLEKSPGKMPRTFEGG
KLVLSGVNWWCSGFFPGTLWYLYEYDGDPVLKEAAERYTKMVETLLTKKTDHDIGFQFNC
SFGNGYRITGTERYKHILIEAAKKLCARFDEKVGCIRSWDSDNNGKWQYPVIIDNMMNLE
LLEFAAKNTGDAKFENIAKSHADKTMQNHFRQDNSSVHVVSYDRKTGKPHLTQTWQGLSD
SSAWARGQAWGLYGYTMMYRETSDESYLKQAEKIARFIMGHKNLPEDKIPYWDFDADGGE
NTLRDASAGAIMASAFIELSTLTKDASLAAECRKTAETQIRSLASPKYLAEVGENGNFFL
KHSVGAIPFKSEVDVPLTYADYYFLEAMLRWKNANK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	67	390	8.7e-127	0.9787234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.07e-10	70	390	29	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH40111.1	7.26e-150	21	392	24	393
QUT50637.1	1.19e-146	22	392	26	395
QIA07645.1	2.94e-146	22	396	25	400
QQT78513.1	5.51e-146	25	392	27	393
QRP59602.1	5.51e-146	25	392	27	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.07e-116	49	396	51	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	1.27e-51	54	391	53	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.30e-51	54	391	54	390	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.82e-51	54	391	54	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	6.99e-51	54	391	54	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	3.14e-90	70	393	77	396	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	1.67e-52	54	391	52	388	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	7.12e-51	54	391	54	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	2.47e-49	39	390	9	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	9.14e-46	54	391	55	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000329	0.998985	0.000182	0.000177	0.000156	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000504_01753.