CAZyme Information: MGYG000000488_00180

Basic Information

• Species: Anaeroplasma sp900767915
• Lineage: Bacteria; Firmicutes; Bacilli; Acholeplasmatales; Anaeroplasmataceae; Anaeroplasma; Anaeroplasma sp900767915
• CAZyme ID: MGYG000000488_00180
• CAZy Family: CBM41
• CAZyme Description: Pullulanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
894	MGYG000000488_2|CGC1	101026	4.8977

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000488	1945837	MAG	Fiji	Oceania

• Gene Location: Start: 30099; End: 32783 Strand: -

Full Sequence      

MKKIIGILFILLTSITLFSCANNSSDLTTSNSTNNENKEYNEAIGFSFHYYRSDADYNNY
NMWIWENGVEGKDYAFTGVDDYGAYMTFSWNDFSKNLKNGSINFIVKEAKVWADNPIKDV
DADRSVTFSSMEFSHEDGLYHIYLKSKDEKIYGVKQEVGEEITKALFDVDNSTKKVRLNI
ATNKAASLIEVKNKGNTIISTNNLDETKVIKKTDTELVYLFDEMPDISSKYIVSVTFSNS
LKIKSTVASVSELYSSSIFNENYYYDGELGAIYSKEETTFKVWSPVSTNIELRIYDSGTP
EKIDVNGKMVSLAGGNNSYKSYQMLKGAKGVWSLTIKEDLEGKYYTYSVTNNSYRSYEIV
DPYAKSAGINGLRGMIVDFEKTNPLGWNDVNVIDYKSQSLTVYECHIADLTSSSTWNGDS
NKAKTFEGFYQSGTTYTSDNTTVKTGFDHIKELGVNTVQLLPIFDQANDERLENRTYNWG
YNPLNYNVLEGAYSSDPYDGYARIKEFKELVKAYNEAGINIVMDVVYNHMNSLAKSNFDV
LMPKYYFRYSNGAISNGSGCGNETASDRLMFRKFMMDSTEFLASEYKLAGFRFDLMGLHD
IETMNELTNNLHDNVNSSITIYGEPWTGGTTTLTQNLQATQANLSKFEGFGCFNDKLRDS
LIKGGLSAKTDKGWITETKKASATNDIISGLIGSQTVLGNDPYKTINYVTCHDNYTLYDR
IKACGITDEETIKNMAVLANSLVFTSQGVSFMLSGEEFLRTKGGNSNSYNASYKVNELDY
SLKIKNMDVFKNYQKLISLKQNSNLFARTKEQCKAIKINTNSDKSLIYFDLVDDEKKLQY
RFAFSNGYKTTLEKKVDFSGYTLYLDTLNKENLTLSSDTVLDELEVIIAYKSIE

Enzyme Prediction     

EC	3.2.1.1	3.2.1.41

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	448	757	1.2e-99	0.9930795847750865
CBM41	48	153	3.7e-16	0.9215686274509803

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02104	pulA_typeI	0.0	259	806	2	532	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
cd11341	AmyAc_Pullulanase_LD-like	2.81e-179	402	800	5	406	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG1523	PulA	4.48e-102	263	809	61	594	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
PLN02877	PLN02877	2.52e-81	258	789	204	806	alpha-amylase/limit dextrinase
TIGR02102	pullulan_Gpos	7.52e-76	49	762	117	814	pullulanase, extracellular, Gram-positive. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. In contrast, a glycogen debranching enzyme such GlgX, homologous to this family, can release glucose at alpha,1-6 linkages from glycogen first subjected to limit degradation by phosphorylase. Characterized members of this family include a surface-located pullulanase from Streptococcus pneumoniae () and an extracellular bifunctional amylase/pullulanase with C-terminal pullulanase activity (.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS39053.1	5.78e-234	15	892	14	888
VEU82346.1	8.16e-168	49	880	34	867
QLY39684.1	1.39e-154	49	806	76	836
VEU81131.1	1.30e-149	49	828	35	822
AUO15617.1	7.37e-147	37	810	135	895

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAN_A	1.84e-110	263	809	311	833	Pullulanasefrom Bacillus acidopullulyticus [Bacillus acidopullulyticus]
7LSA_A	6.78e-106	263	800	57	611	ChainA, Pullulanase [Ruminococcus bromii]
7LSR_A	9.67e-105	263	800	57	611	ChainA, Pullulanase [Ruminococcus bromii]
7LSU_A	1.01e-104	263	800	57	611	ChainA, Pullulanase [Ruminococcus bromii]
7LST_A	1.04e-104	263	800	57	611	ChainA, Pullulanase [Ruminococcus bromii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33840	2.95e-101	49	801	26	746	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
C0SPA0	7.47e-77	246	801	83	614	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1
A0A0H2ZL64	7.14e-53	50	762	235	935	Pullulanase A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) OX=373153 GN=spuA PE=3 SV=1
A0A0H2UNG0	7.34e-53	50	762	250	950	Pullulanase A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=spuA PE=1 SV=1
Q9F930	2.32e-52	50	762	257	957	Pullulanase A OS=Streptococcus pneumoniae OX=1313 GN=spuA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000200	0.999834	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000488_00180.