CAZyme Information: MGYG000000484_01555

Basic Information

• Species: Butyrivibrio_A sp000431815
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Butyrivibrio_A; Butyrivibrio_A sp000431815
• CAZyme ID: MGYG000000484_01555
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000000484_9|CGC3	41538.07	4.3746

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000484	2428908	MAG	Fiji	Oceania

• Gene Location: Start: 48822; End: 49925 Strand: -

Full Sequence      

MPDWIVGMDVSSLVEVEDCGGKFYDNGIEGDALSILKAHGANMVRLRLWNDPYDAEGNSY
SAGYSDIKTVLKLAKRASMLGLDWLLDLHYSDCWADPGKQTIPKAWQGMNVDELETAVYE
YTLNVLKECEEAGLKPQMVAIGNELSNGLLWPYAKVPEYANIARFVSAGIRASREFDAKI
PVMIHLDNGGNNELYRRWFDNYFANNGLDFEYIGLSYYPFWHGTLDMLRDNMNDIASRYG
KKLIVAEVSMGFTLDDYKDYEKLPDELRKGMATKKELAEKVPFPMTPEGQRDFMKAFLDV
IHGIRDNMCEGYFYWEPAWLPVPGSEWATAAACEYMHEKGPGGNEWANQALFDYDGNALC
AMDIIGI

Enzyme Prediction     

No EC number prediction in MGYG000000484_01555.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	5	364	1.6e-128	0.9941520467836257

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	4.04e-131	5	363	1	331	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	3.44e-130	3	364	38	390	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97298.1	7.88e-167	4	365	3	363
CBK91326.1	4.79e-163	1	365	1	364
ACR75146.1	4.79e-163	1	365	1	364
CBK93717.1	4.79e-163	1	365	1	364
CBL13099.1	1.24e-162	3	365	2	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	7.69e-85	3	364	49	390	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	1.51e-79	3	364	23	387	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	1.19e-78	3	364	23	387	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJQ_A	1.41e-54	7	320	6	301	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1HJS_A	1.66e-52	7	364	6	328	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	1.58e-82	4	359	6	340	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q65CX5	1.68e-78	3	364	48	412	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
O07013	7.04e-72	3	364	52	416	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
Q9Y7F8	1.05e-55	7	324	22	322	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
Q8X168	2.07e-55	7	320	22	318	Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger OX=5061 GN=galA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000484_01555.