CAZyme Information: MGYG000000483_00836

Basic Information

• Species: HGM11416 sp900766495
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; HGM11416; HGM11416 sp900766495
• CAZyme ID: MGYG000000483_00836
• CAZy Family: GH35
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	MGYG000000483_15|CGC2	66561.39	5.3665

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000483	1951388	MAG	Fiji	Oceania

• Gene Location: Start: 37748; End: 39511 Strand: +

Full Sequence      

MQRITVKNKNFYKDGKLHYVYSGAIHYFRVLPSCWRDRLEKIKNCGFNAIETYTCWSLHE
RKEGQFDFSGGLDLARFIDIAEETGLDVIIRPGPYICAETDFGGMPSWLLNYSGIGLRSY
DRIFLEKTERYFKELAKIIVPRLAANGGPVQMIQIENEYGSYGNDEKYKRALLEIWKKLG
ADTLFFTADGSDFDMQQNGGMDGVMRSMTFGSRPTVCLEGLKRYGENQPLFCSEYWNGWF
NTYGSDAALCEVERVKNETAEFLSLGSSFNYYMFCGGTNYGMINGANYNDDYMFQTTSYD
YCAPISESGDLTEKYYAIKDEIEKYTGKKIDISVKNSEKKGYPAIKTCGFLPLESVLGDV
KSEKSPYPLSFEKLGVDFGYVYYTTEFDVWLDGKIKLFGLRDRATVIIDGNICGVIGQGT
GCSEIELTVERYGGHRKLGVLVENRGRCNYGPRLKDGKGLSGVLFRDKYLLNYENYPLVA
KVPENAEYKSVESGGVGFYKFNLNISDFPCDTFLYPAGFKNGCVYINGVNIGRFCHTQPP
QRTLYVSASLLKKGENEIIVFDTDGTADPTLEFFDKPFYAETADKRR

Enzyme Prediction     

No EC number prediction in MGYG000000483_00836.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	11	322	3.5e-106	0.990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	1.74e-127	10	320	1	313	Glycosyl hydrolases family 35.
PLN03059	PLN03059	3.43e-47	4	309	30	325	beta-galactosidase; Provisional
COG1874	GanA	8.24e-36	11	579	8	604	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	4.30e-14	35	160	12	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZN43098.1	1.21e-150	1	577	1	588
SMF87753.1	2.55e-149	1	577	1	586
QUG41975.1	8.67e-148	1	575	1	575
AUS98261.1	4.90e-147	1	577	1	577
QUH28654.1	1.04e-146	1	577	1	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	2.71e-138	1	562	15	577	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	9.71e-115	1	577	1	585	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
7KDV_A	1.36e-106	3	577	17	627	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	2.41e-98	1	577	8	619	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	4.35e-98	1	577	32	643	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8IW92	1.71e-109	4	577	47	627	Beta-galactosidase-1-like protein 2 OS=Homo sapiens OX=9606 GN=GLB1L2 PE=1 SV=1
Q54GE1	1.70e-108	20	579	62	670	Beta-galactosidase 1 OS=Dictyostelium discoideum OX=44689 GN=glb1 PE=3 SV=1
A2RSQ1	2.05e-107	14	562	59	613	Beta-galactosidase-1-like protein 3 OS=Mus musculus OX=10090 GN=Glb1l3 PE=1 SV=1
Q58D55	6.90e-106	3	579	32	643	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q5XIL5	1.64e-104	14	585	59	626	Beta-galactosidase-1-like protein 3 OS=Rattus norvegicus OX=10116 GN=Glb1l3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000483_00836.