CAZyme Information: MGYG000000479_00977

Basic Information

• Species: Treponema_D sp900541995
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900541995
• CAZyme ID: MGYG000000479_00977
• CAZy Family: GH57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
661	MGYG000000479_5|CGC1	75612.15	6.5862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000479	2347794	MAG	Fiji	Oceania

• Gene Location: Start: 36795; End: 38780 Strand: +

Full Sequence      

MRMTNVCLILSADEEGNCSPQTFEKNYEAVFRPLLTFLYSHPKFPLAVSFSGLQLEWYAS
KHPEAIQVMRDLTSRKQVEVLGGGYYSPIFPILFPVDRSGQIEKMTSLLRSTVGKRPCGM
SLYGSIWDPTLVTTFQSCGMEYALLDSTLIPAKNLCAHPLITSEQGKTLKILPTYKNLIP
EEDESPEFWIERINNFAKKKRSQTEFFDSEKVVSICFSFEKFASFVKSRCFAYIASCFDI
SMESTSGVNFVLPQTVAKNSDYFERTYIPAGMDWQIARRAVTPFETVENKSRFPLTIHDY
LNAYPQNRRLYQRMMYISMLVTQCKGGDKMRKLSASEKLWEAQSGFNFVTMPCGIPPTEQ
KVQESYRALNEAERLIRDAKEFKESLTSFDYNGDGKNEYICQMEKYHAVISLNAGQITEF
DIIRSCANYAANLSRIAKFDGSNDLYQRGMFIEHLIEPSEIENFKSSGTSSGLLFSNMHF
SEKKFDSKRNEIQMESRGEFSSIKLPVQLRKNYIAFSSGITIQYILKNESYMELDAYFVV
ELNFAKTKFSSLKSASQYSVELIHGENREQVPESGIFSAADGVSFFQITDNSDKKTFVVE
PNEDSGLCTREIVFYRPDEYEKTTESSRTMCVSLYWHVQLAPGMEKEKTINLSVVQAKKK
N

Enzyme Prediction     

No EC number prediction in MGYG000000479_00977.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH57	25	352	7e-38	0.8903394255874674

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10793	GH57N_TLGT_like	2.60e-42	20	211	16	214	N-terminal catalytic domain of 4-alpha-glucanotransferase; glycoside hydrolase family 57 (GH57). 4-alpha-glucanotransferase (TLGT, EC 2.4.1.25) plays a key role in the maltose metabolism. It catalyzes the disproportionation of amylose and the formation of large cyclic alpha-1,4-glucan (cycloamylose) from linear amylose. TLGT functions as a homodimer. Each monomer is composed of two domains, an N-terminal catalytic domain with a (beta/alpha)7 barrel fold and a C-terminal domain with a twisted beta-sandwich fold. Some family members have been designated as alpha-amylases, such as the heat-stable eubacterial amylase from Dictyoglomus thermophilum (DtAmyA) and the extremely thermostable archaeal amylase from Pyrococcus furiosus(PfAmyA). However, both of these proteins are 4-alpha-glucanotransferases. DtAmyA was shown to have transglycosylating activity and PfAmyA exhibits 4-alpha-glucanotransferase activity.
pfam03065	Glyco_hydro_57	1.85e-18	23	208	40	242	Glycosyl hydrolase family 57. This family includes alpha-amylase (EC:3.2.1.1), 4--glucanotransferase (EC:2.4.1.-) and amylopullulanase enzymes.
cd01022	GH57N_like	1.22e-12	24	222	22	252	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.
pfam09095	DUF1926	2.52e-10	390	545	1	188	Domain of unknown function (DUF1926). Members of this family, which are found in a set of prokaryotic transferases, adopt a beta-sandwich fold, in which two layers of anti-parallel beta-sheets are arranged in a nearly parallel fashion. The exact function of this family is, as yet, unknown, however it has been proposed that they may play a role in transglycosylation reactions.
cd10795	GH57N_MJA1_like	1.71e-05	13	117	31	137	N-terminal catalytic domain of a thermoactive alpha-amylase from Methanococcus jannaschii and similar proteins; glycoside hydrolase family 57 (GH57). The subfamily is represented by a thermostable alpha-amylase (MJA1, EC 3.2.1.1) encoded from the hyperthermophilic archaeon Methanococcus jannaschii locus, M J1611. MJA1 has a broad pH optimum 5.0-8.0. It exhibits extremely thermophilic alpha-amylase activity that catalyzes the hydrolysis of large sugar polymers with alpha-l,6 and alpha-l,4 linkages, and yields products including glucose polymers of 1-7 units. MJ1611 also encodes another alpha-amylase with catalytic features distinct from MJA1, which belongs to glycoside hydrolase family 13 (GH-13), and is not included here. This subfamily also includes many uncharacterized proteins found in bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPZ99899.1	0.0	1	661	1	661
AEB14246.1	2.42e-257	7	658	6	653
QOS39947.1	2.54e-223	5	659	4	652
QTQ14015.1	2.41e-174	1	660	1	656
QTQ11807.1	4.82e-174	1	660	1	656

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1K1X_A	1.16e-15	23	178	23	181	Crystalstructure of 4-alpha-glucanotransferase from thermococcus litoralis [Thermococcus litoralis],1K1X_B Crystal structure of 4-alpha-glucanotransferase from thermococcus litoralis [Thermococcus litoralis],1K1Y_A Crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose [Thermococcus litoralis],1K1Y_B Crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose [Thermococcus litoralis]
1K1W_A	2.66e-15	23	178	23	181	Crystalstructure of 4-alpha-glucanotransferase from thermococcus litoralis [Thermococcus litoralis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P09961	2.38e-27	24	543	25	586	Alpha-amylase 1 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) OX=309799 GN=amyA PE=1 SV=2
O57932	1.11e-19	24	545	24	554	Alpha-amylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=amyA PE=3 SV=1
O32450	1.03e-17	24	435	24	438	4-alpha-glucanotransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1809 PE=3 SV=1
P49067	7.21e-17	23	545	24	567	Alpha-amylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=amyA PE=1 SV=2
Q9V298	6.78e-16	24	545	24	575	Alpha-amylase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=amyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000479_00977.