CAZyme Information: MGYG000000451_00349

Basic Information

• Species: UBA1820 sp002314265
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; UBA1820; UBA1820; UBA1820 sp002314265
• CAZyme ID: MGYG000000451_00349
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735	MGYG000000451_3|CGC1	82991.98	6.066

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000451	1842661	MAG	Sweden	Europe

• Gene Location: Start: 90241; End: 92448 Strand: -

Full Sequence      

MKRLRKYLATALILCSLTLPAQNDSTWVGQWITAADCQNTPNTWIILRKTVSIDQVPEPF
EARIAADSKYWMWINDSLVVFEGGLKRGPNPEGTYYDVVDLSPYLKEGENTLAVLLWYFG
KDGFSHKSSGKAGFLFDARKDGVSIVSDPSWQATVYQAFQHTGKPYPNYRLPESNIRYDA
RFALPGWNTTAFKGLLPPAEVLAKAGEKPFGHLVERPIPLWKDYGLRPYEQVRRAGDTLI
CRLPYNCQMTPYIELEAPAGDTIRIQTDNYRGGSENNVRAEYITREGLQAYENPGWMNGH
YVWYILPDGVEVKKVAFRETGYDTEFAGSFACDDLFLNELWKKAARTLYITMRDTYFDCP
DRERAQWWGDAVNELGEAFYALSPSSHKLAAKGIRELVNWQRDNGVLYSPVPGVGTSELP
LQMLASIGWYGFYTQYFYSGDSSFVAEVYEPVHRYLHQVWQVGEDGLPLLRKGDWNWGDW
GEDIDMGVLTTCWYYLALKAEREFATMLGHREDAEKDTRMMEKIEKAFDGAYWTGSVFRS
KEYQGADDDRAQAMAVVSGLASADKYPALTEALKKEYHASPYMEKYVLEALFVMGQPEAA
LHRIHERYAKMMGYKDYTTLFEGWGIGAEGFGGGTINHAWSGGPLTMMSQKVVGIEPTSP
AFETFRVAPQLGKLKHAEASLVTADGSRIRVAVEQDEQGRMTIRLEVPKGKKAQVVFPDG
KTRNVGAGTHKLTGK

Enzyme Prediction     

No EC number prediction in MGYG000000451_00349.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	257	716	1.5e-85	0.9444444444444444
CBM67	30	209	4.4e-30	0.9829545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.21e-28	325	652	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.64e-08	95	192	42	142	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	7.30e-08	654	732	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17167	Glyco_hydro_36	1.07e-06	439	582	142	307	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
COG3459	COG3459	2.59e-04	445	562	710	843	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48047.1	0.0	6	730	2	727
ABR43077.1	0.0	27	732	31	737
QRO16732.1	0.0	27	732	31	737
QCY56550.1	0.0	27	730	31	735
QUT54419.1	0.0	27	732	32	738

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.57e-21	301	711	275	689	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000923	0.972703	0.025538	0.000277	0.000266	0.000278

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000451_00349.