CAZyme Information: MGYG000000449_00985

Basic Information

• Species: CAG-269 sp000438255
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp000438255
• CAZyme ID: MGYG000000449_00985
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640	MGYG000000449_20|CGC1	74279.86	6.3196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000449	1523903	MAG	Sweden	Europe

• Gene Location: Start: 13557; End: 15479 Strand: -

Full Sequence      

MKGMDLQMAQKKRIRDRLFPEGGKIRSYLRTTNRFVKSMFSIDYLKEQKNKIKEKGWRVT
WIEMKRYMVMGTAAEPENLYQIWIEKNEPTKEELQEQKNTKFKINPKISIIIPMYNTPVN
FFEELVDNLIGQTYSNWELCLADGSPEENKELEKIYKKDERIKYKFIGENKGIAGNTNEA
LSLVTGDFVALLDHDDLLPLFSLYEIVKCINENPDAEFIYTDEDKFEKLGGKRYDPYFKS
DFAPDTLRANNFICHFSVFKKELMDKLGGFRSEYDGAQDYDILLRMSEETNKIVHIPKIL
YHWRVHALSTAKAGGTAKPYAYEAGIKAIQDHINRLGLKGTVEQGNTLGTYKINYEVIGN
PKVSIIIPNKDYINTLKVCLNSLKKLTTYENYEIIVVENNSEESETFEYYKKIDGKDKIK
VVYFPEKEFNYSKIINFGVKNSTGDYIIQLNNDTELMTPNWIQEMLGFAQREDVGAVGVE
LFYPDNTIQHAGIIIGIGGVAGHVFKNLPKGIHGYFSKDAMIQNLSAVTAACIMTPKSIY
DDVDYMDEKFKVAFNDVDFCLKIREKGKLIVYNPFVQFKHYESKSRGFEDTPEKKERFQA
EIDRFHDKWQSVLDKGDPYYNINLRLDNDQCAIRTEKVEY

Enzyme Prediction     

No EC number prediction in MGYG000000449_00985.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	109	267	1.5e-22	0.9882352941176471
GT2	364	486	4.9e-22	0.7058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.90e-93	106	305	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	4.49e-31	365	582	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	4.04e-22	109	310	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.99e-17	359	588	1	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	3.11e-17	365	478	1	112	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE14040.1	3.21e-226	13	629	346	955
AWB09765.1	7.50e-216	41	629	166	755
BAV13183.1	4.01e-214	34	633	199	795
ADL50381.1	4.01e-214	34	633	199	795
CDM69534.1	6.02e-209	17	634	152	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.89e-08	108	290	7	206	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.15e-132	106	637	366	901	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	6.38e-96	69	634	277	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71054	2.93e-10	106	304	5	207	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
Q0P9C6	9.52e-10	106	320	2	217	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1
Q48214	1.49e-09	108	289	2	184	Uncharacterized glycosyltransferase HI_1696 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1696 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000449_00985.