CAZyme Information: MGYG000000446_00102

Basic Information

• Species: UMGS1045 sp900547995
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS1045; UMGS1045 sp900547995
• CAZyme ID: MGYG000000446_00102
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1000	MGYG000000446_1|CGC1	111418.35	6.7406

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000446	1423737	MAG	Sweden	Europe

• Gene Location: Start: 97852; End: 100854 Strand: -

Full Sequence      

MKEIKKDNEKKKINFIKKNKNNNSKKINNTKKEENIKKNISNKKKVKDKTVTKKKIMLAL
KILLIIFIVGIIGVLITAAIFLGSIVKNAPEFKPENLYQQESTIMYDANGEIIAKLGIEK
RENISYEELPEVLVNAIIATEDSRFFQHNGFDLPRFLVASFGQLLGRDAGGASTLTMQLS
KNYVSQNTVSEGMAGIKRKFTDIYMSMFKIEKNYTKKEIIEFYVNSNFLGGTSVISGGAY
GVEQACLTYFGKNAKDINVAEAALIAGLFQAPYSYDPYLHPEAAEKRRQTVLYLMERHGY
ITPEEHEIAKELTVDKLILKNPESTGGEYQGFIDTVANEIMDEYGINPYTTPLEIWTTMD
RTKQNHVNSIMNGTESPVTGLTYEWQNDVVNAGISVIDVKTGALVAVGAGRHSGDKALSF
NYATDINNQIGSTAKPLYDYGPGIEFNNWSTYTPFADEPHGYTNGVKIENWNYTYNGFLT
LRQSVMGSWNIPALKAFQSNDKSNIIKFVTGLGLTPEIYSCSDGYKRNKNKCINEDNPND
IVDAKKSDTLHEAHALGGYNGESPLTLSAAYAAFANGGYYIEPHSYTKFTYRTTGETVEK
KIQKTRAMSEQTAYMITDVLISTASSALGRYSYVNGATYGAKTGTSNYPETVFRDYNLPS
NAVNDIWVAGISPEYSIAVWYGYDQVYSDYYNVISSGQNSRIFQAVAKGIFTNTSAKFTK
PSGVVSVTVEKESYPAALPSEFTPDDMKVTELFKSGTEPTDVSTRYSKLNNATNLKANVK
DSKVILTWDKIDTPDAINLDYLNKYFESLYGDATHRQKALNNRLSYNANNIGTVIYNIYL
KDDKGNLTSLGTTENDTYDYTVKDGGTYTFVVKSSYTIFKSNISDGIEVKVNIDKKNDPT
EDDNNVDNINIGLNGDSEISLNIGDKYNEKSVIVIENEKTDVTDKATINITIVRKSDGKT
VNEITTSSADIYTITYKVKYKNASKTLTRKINIVGTPYNS

Enzyme Prediction     

No EC number prediction in MGYG000000446_00102.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	110	295	3.6e-50	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	5.09e-136	120	708	1	526	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	9.79e-129	75	761	28	650	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.82e-83	77	761	22	766	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	3.36e-64	109	296	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	2.75e-46	75	682	7	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS19460.1	1.98e-140	70	858	32	788
QHZ47390.1	2.78e-135	70	772	47	699
ARC65088.1	2.07e-133	70	772	47	699
QDL79483.1	2.07e-133	70	772	47	699
AWI12666.1	3.69e-133	71	902	46	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	3.10e-86	105	724	10	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	7.54e-82	89	724	3	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	1.17e-50	209	722	2	473	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	1.65e-47	209	722	2	473	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2C6W_B	2.27e-39	332	713	9	377	Penicillin-BindingProtein 1a (Pbp-1a) From Streptococcus Pneumoniae [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	5.49e-120	70	789	48	728	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q00573	4.74e-89	78	683	23	600	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q04707	8.12e-86	75	713	20	643	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	1.55e-85	75	713	20	643	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
Q891X1	2.96e-64	84	771	41	718	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999709	0.000289	0.000001	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
62	84