CAZyme Information: MGYG000000442_02553

Basic Information

• Species: CAG-462 sp003489705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp003489705
• CAZyme ID: MGYG000000442_02553
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296		35165.3	9.9987

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000442	3125088	MAG	Sweden	Europe

• Gene Location: Start: 1621; End: 2511 Strand: +

Full Sequence      

MMNISRWHLVLVCLMLTMFSFGQTRTKAYESYIRKYKDLAIEQMDRYHIPASITLAQGLL
ESGAGKSELARRSNNHFGIKCGGTWTGRTVYYDDDARGECFRAYKSVRESYEDHSRFLTV
RGRYSFLFKLKKTDYKGWARGLKKAGYATNPRYAEQLINIIELYDLDELDTKKGRRKYDN
PVRFIHEVYKANDLIYIIARDGDTFESLSNEFEISKRKLRKYNDLYKDYRFRAGDIVYLE
EKHRKARKPHIIHRVKDGESMYTIAQTYGIKLKNLYKMNKKDEDYVPRVGDYLRLR

Enzyme Prediction     

No EC number prediction in MGYG000000442_02553.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	38	166	6.4e-36	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.29e-39	30	174	44	192	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	8.93e-36	40	170	171	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	2.46e-30	26	166	5	141	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	9.34e-29	37	166	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02541	flagell_FlgJ	7.26e-27	49	161	168	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR67483.1	1.20e-137	22	296	24	298
QJR58959.1	1.20e-137	22	296	24	298
QJR63222.1	1.20e-137	22	296	24	298
QJR71820.1	1.20e-137	22	296	24	298
ALA74116.1	1.20e-137	22	296	24	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	2.73e-16	49	161	21	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.34e-16	49	161	22	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.33e-15	49	161	22	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	2.08e-10	49	183	80	227	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3FI7_A	7.22e-08	30	170	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.15e-18	45	170	64	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P37710	1.28e-15	51	286	202	464	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9X9J3	5.37e-12	30	160	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P75942	3.79e-10	49	162	169	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	3.79e-10	49	162	169	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000311	0.998987	0.000259	0.000144	0.000149	0.000142

TMHMM  Annotations     

start	end
7	24