CAZyme Information: MGYG000000437_01302

Basic Information

• Species: Alistipes sp001941065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp001941065
• CAZyme ID: MGYG000000437_01302
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
762		83985.03	5.065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000437	3341375	MAG	Sweden	Europe

• Gene Location: Start: 1847; End: 4135 Strand: -

Full Sequence      

MHTLLLTAAACSLLGGCGVSSPPEARWITSGEAGADQPNTWIAYRHNVGVAEIPREAVVR
IAADTKYWLWVNGDLVVFEGGLKRGPTPDDTYYDRVDLAPYLHRGENRIALLLWHFGKEG
FSHRDSGRSGVIVASESRGFELASDSSWLCRIHPAYGTAGDPQPNFRLAESNIRFDARQE
MAGWQTADAAELDGFRPAVAVGGWGDAPWNRLVERPIPQWKDFGIEEVPFERRADGRVTA
QLPYNMQLTPVLTLTDPVGGRLVGIATDHAYAGGQWNVRAEYVTRPGTQTYESLGWMNGQ
QIVLDVPEGVEIGKVAYRQTGYDTEASGSFSCDDDFYNRFWQKALRTLYVNMRDNYFDCP
DRERAQWWGDVVLLMGESFYSYSTSAHALMRKAMLELAAWQKPDGALFSPVPAGNYDNEL
PGQMLASVGHYGFWNYYMNTGDAETVAAVYPAVKKYLALWSLDATGLTEFRQGGWTWGDW
GDNRDIRLLFAGWHSLALQGAADMADLLGFGDDAAAYRATAEQVKAGYNACWNGTAYRHP
AYGGETDDRAQALAVLAGIAPEEHYPALLKVLQTEFHASPYMEKYVMEALFRMGYGRYAL
ERTRTRFAEMVDSPEHTTLFEGWGIGEKGFGGGTTNHAWSGGALTVLAGQLCGIAPLEAG
YRTFLVEPDPASFGSASIAVPTVRGTIRSAFTNGDGGFELRLTVPEGTEAVVRLPESAGA
ATIDGREPSARQRRVDSAWQRNRRVAFLLTAGEHRIVCDRAL

Enzyme Prediction     

No EC number prediction in MGYG000000437_01302.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	279	714	2.8e-90	0.8849206349206349
CBM67	25	209	4.8e-33	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.88e-32	328	642	4	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.82e-14	653	720	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	6.51e-05	54	218	3	156	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam04685	DUF608	2.70e-04	434	538	109	217	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKZ15800.1	0.0	27	762	17	753
QXU44133.1	0.0	27	762	46	782
ASM67368.1	0.0	24	726	25	730
QQT79846.1	0.0	24	726	24	729
QRP59702.1	0.0	24	726	24	729

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.36e-14	24	218	7	196	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3W5M_A	4.24e-14	93	715	356	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	7.44e-14	44	760	187	951	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	2.31e-13	93	715	356	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.30e-06	327	715	473	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000034	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000437_01302.