CAZyme Information: MGYG000000428_00683

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1795
• CAZyme ID: MGYG000000428_00683
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000000428_17|CGC1	72676.9	4.7346

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000428	1789472	MAG	Sweden	Europe

• Gene Location: Start: 24744; End: 26663 Strand: +

Full Sequence      

MQSGDFNVNKKAFTAIWNGDTSARDTYVDFKDNFAADCGERIFIEISCDSNYSAYVNGKP
VAFSACSDYPFAREYDKIDVTEYCKENNELFVTVWHYGEDSQVYINADAFLAYKIIQGGK
TLASSGKNTLSRINPFYKNGYCKKITVQLGYSFLFDANGDDNAPFTKSDEAGEVFAAERK
RKPLALIGRASQNIEKNDGGYLIDFGREVVGYPDFSFTSAVKQKLTLSYGEHLTEDGKVP
RIIGDRDFSVEYIAKPGKNEYFNAFRRLACRYMFVECEKDIIIDYIGLDEVVYPVERKKF
TLSDEFLQRIYDAGVRTLRACMHEHYEDCPWREQALYALDSRNQMLCGYYAFEGGEYQRY
NLTLLAKSLDGGLLAICAPSGVRLPIPFFSLMFFVQTYEYVLHTGDRSILEEVGDTLAAL
YRTFSERVDESGLIPVFPSPCWNFYEWSEGSSDCRKDERGNAIENQYDLILNCAYVYAMR
AYERLTGWKLDARKTVRAIEKTFFDKEKGMYKLNTLEESYSQLGNAFALLIGLGDDALAE
KTARGEDMVPITLSMNTFLYDALIARGENYRDFIVKDIKNKYGKMLSGETGTFWETELGA
ADFGGAGSLCHGWSAIPVYYLQCFFGKKQEGDLLDKTRE

Enzyme Prediction     

No EC number prediction in MGYG000000428_00683.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	196	621	4.6e-62	0.8571428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.26e-17	300	621	6	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.30e-04	194	276	1	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95627.1	2.02e-120	16	620	14	703
ARN56684.1	1.28e-91	44	620	56	707
QNK57365.1	7.41e-91	16	624	10	712
QGQ97405.1	4.90e-83	16	624	12	713
AQQ71631.1	1.35e-70	27	621	25	688

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	9.89e-21	195	625	188	636	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000428_00683.