CAZyme Information: MGYG000000426_00855

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA5026
• CAZyme ID: MGYG000000426_00855
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000000426_14|CGC1	43489.42	6.6933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000426	1083370	MAG	Sweden	Europe

• Gene Location: Start: 369; End: 1460 Strand: +

Full Sequence      

MKKYKICVYAISKNEEKFVERWVKSMSEADKIFVLDTGSTDNTVRKLKELGVNVEIKNFL
PWRFDTARNESLKLVDEDTDICVCTDIDEVFEKGWRKKLEENWSNDTTRCRYSYYWSLDD
KDKPKVSFFIDKIHKRFGYSWTHPVHEVLKYNGNENIITIKDILLKHYPDSSKSRSSYLP
LLELSTLEDPTDDRNMHYLGREYMYYGKWNEAIDTLIKHLSLEKATWKDERAASMRYIAR
SYKNLKRYDEARMWLDKSMNEAPYLRDAYVERGILEYELNNYSSACIYLEKALEIKDHTM
SYIHEVFSWNETIYDLLSICYYNLGEFKKSYNNVCIANELNPDDTRIKENKKIIYNKIKK
EEI

Enzyme Prediction     

No EC number prediction in MGYG000000426_00855.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	2.21e-12	5	169	1	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	3.03e-10	196	294	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	5.54e-08	232	330	1	88	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
pfam13424	TPR_12	1.96e-06	230	295	1	74	Tetratricopeptide repeat.
cd00761	Glyco_tranf_GTA_type	1.21e-05	6	99	3	98	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58818.1	2.29e-125	1	354	1	356
AQS58819.1	6.50e-123	1	358	1	360
ACV63878.1	4.77e-122	1	356	1	357
AIY08392.1	3.74e-121	2	358	5	363
AHM67664.1	3.74e-121	2	358	5	363

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000426_00855.