CAZyme Information: MGYG000000422_01441

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1
• CAZyme ID: MGYG000000422_01441
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42413.8	9.7647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000422	1769950	MAG	Sweden	Europe

• Gene Location: Start: 16811; End: 17932 Strand: -

Full Sequence      

MKKLFIVTGEYSGDIHASHVVEALRNLNSNIRIEGIGGDNMQKAGVKLFTNHAKMSSVGL
SPQIIINHILLGKRLVNYLVNDYKPDAVLLIDYGGFNLRIAKYLKKAGIKVLYYIPPQIW
ASRKGRIKKIKQNIDEVLCIFPFEKPLYESYGIKCHYCGHPLVSQLPPKADREEFFTKHG
FDPKKKLVSIFPGSRVFELKYLMDVFIKSAKELQKKHPDLQFCISHAPNLSDKVYDKFLK
QTDFPVIKGENQALLSVSDALILASGTVALEACLYQTPMIIAYRGPWLFYFIYLLVRCIK
QVSLPNIIANKLIVPEIIQGNVNKNKISYEVERLLFDVKYRENNISQLGEVKDLLSAKVS
SSEVANEIYKTLQ

Enzyme Prediction     

No EC number prediction in MGYG000000422_01441.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	354	1e-109	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	8.94e-127	1	368	1	371	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.70e-109	1	373	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.83e-83	4	343	1	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	9.48e-69	6	320	10	330	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.87e-46	1	370	1	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	1.45e-209	1	372	1	372
QBA65008.1	1.28e-77	3	368	2	366
CBJ11828.1	2.10e-76	2	370	5	382
QIN35535.1	2.10e-76	2	370	5	382
QIN32187.1	2.10e-76	2	370	5	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.30e-47	6	339	11	349	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.62e-47	6	339	11	349	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	2.00e-74	2	372	7	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B8JE78	1.54e-73	3	368	10	378	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	8.58e-73	3	368	10	378	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q74AT9	8.82e-73	3	372	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B6J161	9.92e-73	2	372	4	374	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000422_01441.