CAZyme Information: MGYG000000415_01435

Basic Information

• Species: UBA11471 sp900547555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900547555
• CAZyme ID: MGYG000000415_01435
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452		49510.37	4.6517

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000415	2630685	MAG	Sweden	Europe

• Gene Location: Start: 3931; End: 5289 Strand: +

Full Sequence      

MSSAQSVPFSVKENLFDQSNTNTLGLDYVSGVETVTVFSPTDDTDKFSNGVVMAAFKGSL
YCMWQSSATDEDAADTWVAYSRSDDDGKTWSAPMVLAETLDDGYCSSGGWIATSDTLVGF
INTWPSGLSPKGGYTRYVKSSDGLNWSEPAEVKMKNGSRLEAVFEQDPHVLANGRIVNAA
HFQPGLLVCPIYTDDPLGITGWEKGRFSHTGSGDQSRELEPSLYQRKDGTIVMVFRDQNS
TYYKLASESKDNGETWSHSVLTNMPDARTKQSAGNLPDGTSYLVGNPVTDKTRIPLAITL
STDGVFFDKAYLIREGGLSMPALRYEGKAKRLGYHYPKSMVDGDFLYVAYALNKEDVQYT
RIPLNSVSLPASVTDIDAGRRVIGVVNGILYVDCETEIVKNIEVYNISGACCLTHSYARS
SCECDLSDLRRGLYVVKVTTDSAIHTSMILLE

Enzyme Prediction     

No EC number prediction in MGYG000000415_01435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	47	326	4.4e-23	0.8391812865497076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	2.92e-55	58	348	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	1.96e-25	35	363	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	7.25e-07	219	363	241	372	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam18962	Por_Secre_tail	3.60e-05	386	442	6	63	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
TIGR04183	Por_Secre_tail	0.002	395	452	16	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ79596.1	3.33e-133	11	364	347	701
QDT41634.1	1.86e-21	26	371	259	593
QDT90248.1	6.28e-19	36	375	269	597
QGQ30950.1	7.45e-19	36	375	5	333
QEG15775.1	3.56e-18	36	375	269	597

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQS_A	2.86e-13	26	364	45	405	SialidaseBT_1020 [Bacteroides thetaiotaomicron]
5MQR_A	3.58e-12	26	364	45	405	SialidaseBT_1020 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000415_01435.